2I0SD

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
Knots found
sequence length
124
structure length
123
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 34
structure length 123
sequence length 124
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2i0sD00
4FAVC 2H3XB 2J56L 2OJYD 1MG3B 4FA9C 2IAAB 2AGXD 2HJBD 2IUVD 3RLMC 2HXCD 3RN1C 2HJ4D 3SVWC 2IURD 3PXWC 3ORVC 4Y5RC 1MG2B 2AGWD 2HKMD 2IUPD 4FA5C 3SXTC 2J55L 2HKRD 4L1QC 4FA4C 4FB1C 2H47B 3C75L 2MADL 3PXTC 3RN0C 3PXSC 4O1QC 2GC4B 3L4MC 2I0RD 4FA1C 2J57K 1MDAL 2GC7B 2Q7QD 1MAFL 2AGLD 3L4OC 4K3IC 3RMZC 1MAEL 2BBKL 2AH1D 3SWSC 2AH0D 2AGYD 4L3HC 2IUQD 2MTAL 2I0TD 4L3GC 2OK6D 4FANC 2AGZD 2I0SD 2OK4D 3SLEC 3SJLC 2OIZD
chains in the Genus database with same CATH superfamily
4FAVC 2H3XB 2J56L 2OJYD 1MG3B 4FA9C 2IAAB 2AGXD 2HJBD 2IUVD 3RLMC 2HXCD 3RN1C 2HJ4D 3SVWC 2IURD 3PXWC 3ORVC 4Y5RC 1MG2B 2AGWD 2HKMD 2IUPD 4FA5C 3SXTC 2J55L 2HKRD 4L1QC 4FA4C 4FB1C 2H47B 3C75L 2MADL 3PXTC 3RN0C 3PXSC 4O1QC 2GC4B 3L4MC 2I0RD 4FA1C 2J57K 1MDAL 2GC7B 2Q7QD 1MAFL 2AGLD 3L4OC 4K3IC 3RMZC 1MAEL 2BBKL 2AH1D 3SWSC 2AH0D 2AGYD 4L3HC 2IUQD 2MTAL 2I0TD 4L3GC 2OK6D 4FANC 2AGZD 2I0SD 2OK4D 3SLEC 3SJLC 2OIZD
chains in the Genus database with same CATH topology
4FAVC 2H3XB 2J56L 2OJYD 1MG3B 4FA9C 2IAAB 2AGXD 2HJBD 2IUVD 3RLMC 2HXCD 3RN1C 2HJ4D 3SVWC 2IURD 3PXWC 3ORVC 4Y5RC 1MG2B 2AGWD 2HKMD 2IUPD 4FA5C 3SXTC 2J55L 2HKRD 4L1QC 4FA4C 4FB1C 2H47B 3C75L 2MADL 3PXTC 3RN0C 3PXSC 4O1QC 2GC4B 3L4MC 2I0RD 4FA1C 2J57K 1MDAL 2GC7B 2Q7QD 1MAFL 2AGLD 3L4OC 4K3IC 3RMZC 1MAEL 2BBKL 2AH1D 3SWSC 2AH0D 2AGYD 4L3HC 2IUQD 2MTAL 2I0TD 4L3GC 2OK6D 4FANC 2AGZD 2I0SD 2OK4D 3SLEC 3SJLC 2OIZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV C;  2H3X B;  2J56 L;  2OJY D;  1MG3 B;  4FA9 C;  2IAA B;  2AGX D;  2HJB D;  2IUV D;  3RLM C;  2HXC D;  3RN1 C;  2HJ4 D;  3SVW C;  2IUR D;  3PXW C;  3ORV C;  4Y5R C;  1MG2 B;  2AGW D;  2HKM D;  2IUP D;  4FA5 C;  3SXT C;  2J55 L;  2HKR D;  4L1Q C;  4FA4 C;  4FB1 C;  2H47 B;  3C75 L;  2MAD L;  3PXT C;  3RN0 C;  3PXS C;  4O1Q C;  2GC4 B;  3L4M C;  2I0R D;  4FA1 C;  2J57 K;  1MDA L;  2GC7 B;  2Q7Q D;  1MAF L;  2AGL D;  3L4O C;  4K3I C;  3RMZ C;  1MAE L;  2BBK L;  2AH1 D;  3SWS C;  2AH0 D;  2AGY D;  4L3H C;  2IUQ D;  2MTA L;  2I0T D;  4L3G C;  2OK6 D;  4FAN C;  2AGZ D;  2I0S D;  2OK4 D;  3SLE C;  3SJL C;  2OIZ D; 
#chains in the Genus database with same CATH topology
 4FAV C;  2H3X B;  2J56 L;  2OJY D;  1MG3 B;  4FA9 C;  2IAA B;  2AGX D;  2HJB D;  2IUV D;  3RLM C;  2HXC D;  3RN1 C;  2HJ4 D;  3SVW C;  2IUR D;  3PXW C;  3ORV C;  4Y5R C;  1MG2 B;  2AGW D;  2HKM D;  2IUP D;  4FA5 C;  3SXT C;  2J55 L;  2HKR D;  4L1Q C;  4FA4 C;  4FB1 C;  2H47 B;  3C75 L;  2MAD L;  3PXT C;  3RN0 C;  3PXS C;  4O1Q C;  2GC4 B;  3L4M C;  2I0R D;  4FA1 C;  2J57 K;  1MDA L;  2GC7 B;  2Q7Q D;  1MAF L;  2AGL D;  3L4O C;  4K3I C;  3RMZ C;  1MAE L;  2BBK L;  2AH1 D;  3SWS C;  2AH0 D;  2AGY D;  4L3H C;  2IUQ D;  2MTA L;  2I0T D;  4L3G C;  2OK6 D;  4FAN C;  2AGZ D;  2I0S D;  2OK4 D;  3SLE C;  3SJL C;  2OIZ D; 
#chains in the Genus database with same CATH homology
 4FAV C;  2H3X B;  2J56 L;  2OJY D;  1MG3 B;  4FA9 C;  2IAA B;  2AGX D;  2HJB D;  2IUV D;  3RLM C;  2HXC D;  3RN1 C;  2HJ4 D;  3SVW C;  2IUR D;  3PXW C;  3ORV C;  4Y5R C;  1MG2 B;  2AGW D;  2HKM D;  2IUP D;  4FA5 C;  3SXT C;  2J55 L;  2HKR D;  4L1Q C;  4FA4 C;  4FB1 C;  2H47 B;  3C75 L;  2MAD L;  3PXT C;  3RN0 C;  3PXS C;  4O1Q C;  2GC4 B;  3L4M C;  2I0R D;  4FA1 C;  2J57 K;  1MDA L;  2GC7 B;  2Q7Q D;  1MAF L;  2AGL D;  3L4O C;  4K3I C;  3RMZ C;  1MAE L;  2BBK L;  2AH1 D;  3SWS C;  2AH0 D;  2AGY D;  4L3H C;  2IUQ D;  2MTA L;  2I0T D;  4L3G C;  2OK6 D;  4FAN C;  2AGZ D;  2I0S D;  2OK4 D;  3SLE C;  3SJL C;  2OIZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...