2I0SD

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
Knots found
sequence length
124
structure length
123
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 34
structure length 123
sequence length 124
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2i0sD00
3PXSC 2IURD 2H3XB 2IAAB 2J56L 4FB1C 4FA9C 2AGXD 2OK6D 1MDAL 2GC4B 2I0RD 2OK4D 2Q7QD 3PXTC 2I0TD 3RN0C 4K3IC 3SJLC 2IUVD 4FA5C 4L1QC 3SLEC 2J57K 4L3HC 3RMZC 3SWSC 1MG3B 2AH0D 2IUQD 2I0SD 4FA1C 2J55L 2HKMD 2IUPD 2AGLD 2MADL 2HXCD 1MAEL 3PXWC 4Y5RC 2HJ4D 2OIZD 2AH1D 2AGWD 1MAFL 2OJYD 2MTAL 4FA4C 4FANC 3RN1C 4L3GC 3C75L 3L4OC 2AGYD 2H47B 3L4MC 3RLMC 2HKRD 2HJBD 3SXTC 2GC7B 1MG2B 4O1QC 2BBKL 3ORVC 3SVWC 2AGZD 4FAVC
chains in the Genus database with same CATH superfamily
3PXSC 2IURD 2H3XB 2IAAB 2J56L 4FB1C 4FA9C 2AGXD 2OK6D 1MDAL 2GC4B 2I0RD 2OK4D 2Q7QD 3PXTC 2I0TD 3RN0C 4K3IC 3SJLC 2IUVD 4FA5C 4L1QC 3SLEC 2J57K 4L3HC 3RMZC 3SWSC 1MG3B 2AH0D 2IUQD 2I0SD 4FA1C 2J55L 2HKMD 2IUPD 2AGLD 2MADL 2HXCD 1MAEL 3PXWC 4Y5RC 2HJ4D 2OIZD 2AH1D 2AGWD 1MAFL 2OJYD 2MTAL 4FA4C 4FANC 3RN1C 4L3GC 3C75L 3L4OC 2AGYD 2H47B 3L4MC 3RLMC 2HKRD 2HJBD 3SXTC 2GC7B 1MG2B 4O1QC 2BBKL 3ORVC 3SVWC 2AGZD 4FAVC
chains in the Genus database with same CATH topology
3PXSC 2IURD 2H3XB 2IAAB 2J56L 4FB1C 4FA9C 2AGXD 2OK6D 1MDAL 2GC4B 2I0RD 2OK4D 2Q7QD 3PXTC 2I0TD 3RN0C 4K3IC 3SJLC 2IUVD 4FA5C 4L1QC 3SLEC 2J57K 4L3HC 3RMZC 3SWSC 1MG3B 2AH0D 2IUQD 2I0SD 4FA1C 2J55L 2HKMD 2IUPD 2AGLD 2MADL 2HXCD 1MAEL 3PXWC 4Y5RC 2HJ4D 2OIZD 2AH1D 2AGWD 1MAFL 2OJYD 2MTAL 4FA4C 4FANC 3RN1C 4L3GC 3C75L 3L4OC 2AGYD 2H47B 3L4MC 3RLMC 2HKRD 2HJBD 3SXTC 2GC7B 1MG2B 4O1QC 2BBKL 3ORVC 3SVWC 2AGZD 4FAVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXS C;  2IUR D;  2H3X B;  2IAA B;  2J56 L;  4FB1 C;  4FA9 C;  2AGX D;  2OK6 D;  1MDA L;  2GC4 B;  2I0R D;  2OK4 D;  2Q7Q D;  3PXT C;  2I0T D;  3RN0 C;  4K3I C;  3SJL C;  2IUV D;  4FA5 C;  4L1Q C;  3SLE C;  2J57 K;  4L3H C;  3RMZ C;  3SWS C;  1MG3 B;  2AH0 D;  2IUQ D;  2I0S D;  4FA1 C;  2J55 L;  2HKM D;  2IUP D;  2AGL D;  2MAD L;  2HXC D;  1MAE L;  3PXW C;  4Y5R C;  2HJ4 D;  2OIZ D;  2AH1 D;  2AGW D;  1MAF L;  2OJY D;  2MTA L;  4FA4 C;  4FAN C;  3RN1 C;  4L3G C;  3C75 L;  3L4O C;  2AGY D;  2H47 B;  3L4M C;  3RLM C;  2HKR D;  2HJB D;  3SXT C;  2GC7 B;  1MG2 B;  4O1Q C;  2BBK L;  3ORV C;  3SVW C;  2AGZ D;  4FAV C; 
#chains in the Genus database with same CATH topology
 3PXS C;  2IUR D;  2H3X B;  2IAA B;  2J56 L;  4FB1 C;  4FA9 C;  2AGX D;  2OK6 D;  1MDA L;  2GC4 B;  2I0R D;  2OK4 D;  2Q7Q D;  3PXT C;  2I0T D;  3RN0 C;  4K3I C;  3SJL C;  2IUV D;  4FA5 C;  4L1Q C;  3SLE C;  2J57 K;  4L3H C;  3RMZ C;  3SWS C;  1MG3 B;  2AH0 D;  2IUQ D;  2I0S D;  4FA1 C;  2J55 L;  2HKM D;  2IUP D;  2AGL D;  2MAD L;  2HXC D;  1MAE L;  3PXW C;  4Y5R C;  2HJ4 D;  2OIZ D;  2AH1 D;  2AGW D;  1MAF L;  2OJY D;  2MTA L;  4FA4 C;  4FAN C;  3RN1 C;  4L3G C;  3C75 L;  3L4O C;  2AGY D;  2H47 B;  3L4M C;  3RLM C;  2HKR D;  2HJB D;  3SXT C;  2GC7 B;  1MG2 B;  4O1Q C;  2BBK L;  3ORV C;  3SVW C;  2AGZ D;  4FAV C; 
#chains in the Genus database with same CATH homology
 3PXS C;  2IUR D;  2H3X B;  2IAA B;  2J56 L;  4FB1 C;  4FA9 C;  2AGX D;  2OK6 D;  1MDA L;  2GC4 B;  2I0R D;  2OK4 D;  2Q7Q D;  3PXT C;  2I0T D;  3RN0 C;  4K3I C;  3SJL C;  2IUV D;  4FA5 C;  4L1Q C;  3SLE C;  2J57 K;  4L3H C;  3RMZ C;  3SWS C;  1MG3 B;  2AH0 D;  2IUQ D;  2I0S D;  4FA1 C;  2J55 L;  2HKM D;  2IUP D;  2AGL D;  2MAD L;  2HXC D;  1MAE L;  3PXW C;  4Y5R C;  2HJ4 D;  2OIZ D;  2AH1 D;  2AGW D;  1MAF L;  2OJY D;  2MTA L;  4FA4 C;  4FAN C;  3RN1 C;  4L3G C;  3C75 L;  3L4O C;  2AGY D;  2H47 B;  3L4M C;  3RLM C;  2HKR D;  2HJB D;  3SXT C;  2GC7 B;  1MG2 B;  4O1Q C;  2BBK L;  3ORV C;  3SVW C;  2AGZ D;  4FAV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...