2J57K

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
total genus 32
structure length 124
sequence length 125
chains with identical sequence L, M, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j57K00
2J55L 2H3XB 2AGXD 2HKMD 4L3HC 3RLMC 2Q7QD 2AH1D 3L4OC 4L3GC 1MDAL 3RN0C 4L1QC 3SVWC 4FAVC 2IURD 1MG3B 3PXSC 2AGYD 2AGZD 2HJBD 2OK4D 4FA4C 2AGWD 4FA5C 2OIZD 3RN1C 4FANC 3SWSC 4K3IC 4O1QC 3L4MC 1MG2B 2HKRD 2I0TD 2MADL 4Y5RC 4FB1C 2IUPD 2H47B 2HJ4D 4FA1C 2GC7B 2J56L 1MAFL 2IAAB 3SXTC 2OJYD 2I0SD 3PXWC 2AGLD 3RMZC 2OK6D 1MAEL 2IUQD 3PXTC 2MTAL 3ORVC 3SJLC 2IUVD 3C75L 2GC4B 2J57K 2HXCD 2I0RD 4FA9C 2AH0D 2BBKL 3SLEC
chains in the Genus database with same CATH superfamily
2J55L 2H3XB 2AGXD 2HKMD 4L3HC 3RLMC 2Q7QD 2AH1D 3L4OC 4L3GC 1MDAL 3RN0C 4L1QC 3SVWC 4FAVC 2IURD 1MG3B 3PXSC 2AGYD 2AGZD 2HJBD 2OK4D 4FA4C 2AGWD 4FA5C 2OIZD 3RN1C 4FANC 3SWSC 4K3IC 4O1QC 3L4MC 1MG2B 2HKRD 2I0TD 2MADL 4Y5RC 4FB1C 2IUPD 2H47B 2HJ4D 4FA1C 2GC7B 2J56L 1MAFL 2IAAB 3SXTC 2OJYD 2I0SD 3PXWC 2AGLD 3RMZC 2OK6D 1MAEL 2IUQD 3PXTC 2MTAL 3ORVC 3SJLC 2IUVD 3C75L 2GC4B 2J57K 2HXCD 2I0RD 4FA9C 2AH0D 2BBKL 3SLEC
chains in the Genus database with same CATH topology
2J55L 2H3XB 2AGXD 2HKMD 4L3HC 3RLMC 2Q7QD 2AH1D 3L4OC 4L3GC 1MDAL 3RN0C 4L1QC 3SVWC 4FAVC 2IURD 1MG3B 3PXSC 2AGYD 2AGZD 2HJBD 2OK4D 4FA4C 2AGWD 4FA5C 2OIZD 3RN1C 4FANC 3SWSC 4K3IC 4O1QC 3L4MC 1MG2B 2HKRD 2I0TD 2MADL 4Y5RC 4FB1C 2IUPD 2H47B 2HJ4D 4FA1C 2GC7B 2J56L 1MAFL 2IAAB 3SXTC 2OJYD 2I0SD 3PXWC 2AGLD 3RMZC 2OK6D 1MAEL 2IUQD 3PXTC 2MTAL 3ORVC 3SJLC 2IUVD 3C75L 2GC4B 2J57K 2HXCD 2I0RD 4FA9C 2AH0D 2BBKL 3SLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J55 L;  2H3X B;  2AGX D;  2HKM D;  4L3H C;  3RLM C;  2Q7Q D;  2AH1 D;  3L4O C;  4L3G C;  1MDA L;  3RN0 C;  4L1Q C;  3SVW C;  4FAV C;  2IUR D;  1MG3 B;  3PXS C;  2AGY D;  2AGZ D;  2HJB D;  2OK4 D;  4FA4 C;  2AGW D;  4FA5 C;  2OIZ D;  3RN1 C;  4FAN C;  3SWS C;  4K3I C;  4O1Q C;  3L4M C;  1MG2 B;  2HKR D;  2I0T D;  2MAD L;  4Y5R C;  4FB1 C;  2IUP D;  2H47 B;  2HJ4 D;  4FA1 C;  2GC7 B;  2J56 L;  1MAF L;  2IAA B;  3SXT C;  2OJY D;  2I0S D;  3PXW C;  2AGL D;  3RMZ C;  2OK6 D;  1MAE L;  2IUQ D;  3PXT C;  2MTA L;  3ORV C;  3SJL C;  2IUV D;  3C75 L;  2GC4 B;  2J57 K;  2HXC D;  2I0R D;  4FA9 C;  2AH0 D;  2BBK L;  3SLE C; 
#chains in the Genus database with same CATH topology
 2J55 L;  2H3X B;  2AGX D;  2HKM D;  4L3H C;  3RLM C;  2Q7Q D;  2AH1 D;  3L4O C;  4L3G C;  1MDA L;  3RN0 C;  4L1Q C;  3SVW C;  4FAV C;  2IUR D;  1MG3 B;  3PXS C;  2AGY D;  2AGZ D;  2HJB D;  2OK4 D;  4FA4 C;  2AGW D;  4FA5 C;  2OIZ D;  3RN1 C;  4FAN C;  3SWS C;  4K3I C;  4O1Q C;  3L4M C;  1MG2 B;  2HKR D;  2I0T D;  2MAD L;  4Y5R C;  4FB1 C;  2IUP D;  2H47 B;  2HJ4 D;  4FA1 C;  2GC7 B;  2J56 L;  1MAF L;  2IAA B;  3SXT C;  2OJY D;  2I0S D;  3PXW C;  2AGL D;  3RMZ C;  2OK6 D;  1MAE L;  2IUQ D;  3PXT C;  2MTA L;  3ORV C;  3SJL C;  2IUV D;  3C75 L;  2GC4 B;  2J57 K;  2HXC D;  2I0R D;  4FA9 C;  2AH0 D;  2BBK L;  3SLE C; 
#chains in the Genus database with same CATH homology
 2J55 L;  2H3X B;  2AGX D;  2HKM D;  4L3H C;  3RLM C;  2Q7Q D;  2AH1 D;  3L4O C;  4L3G C;  1MDA L;  3RN0 C;  4L1Q C;  3SVW C;  4FAV C;  2IUR D;  1MG3 B;  3PXS C;  2AGY D;  2AGZ D;  2HJB D;  2OK4 D;  4FA4 C;  2AGW D;  4FA5 C;  2OIZ D;  3RN1 C;  4FAN C;  3SWS C;  4K3I C;  4O1Q C;  3L4M C;  1MG2 B;  2HKR D;  2I0T D;  2MAD L;  4Y5R C;  4FB1 C;  2IUP D;  2H47 B;  2HJ4 D;  4FA1 C;  2GC7 B;  2J56 L;  1MAF L;  2IAA B;  3SXT C;  2OJY D;  2I0S D;  3PXW C;  2AGL D;  3RMZ C;  2OK6 D;  1MAE L;  2IUQ D;  3PXT C;  2MTA L;  3ORV C;  3SJL C;  2IUV D;  3C75 L;  2GC4 B;  2J57 K;  2HXC D;  2I0R D;  4FA9 C;  2AH0 D;  2BBK L;  3SLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...