2J57K

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 124
sequence length 125
chains with identical sequence L, M, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j57K00
4FANC 2OJYD 4L3HC 2IURD 2HJ4D 2AGXD 3SJLC 3SVWC 1MAFL 2AGZD 2BBKL 1MG2B 2IUPD 2GC4B 2AH0D 2IUQD 3PXWC 3RN0C 2AGLD 4Y5RC 2H3XB 4L3GC 4L1QC 3SWSC 2IUVD 2AH1D 4FAVC 3RN1C 2MTAL 2HJBD 2I0RD 3C75L 2OIZD 4FA5C 4FA9C 2H47B 1MAEL 1MDAL 2J56L 3RLMC 2IAAB 3L4OC 3SXTC 3ORVC 2HKMD 2MADL 2Q7QD 2I0TD 3PXSC 3RMZC 2GC7B 4FA4C 2I0SD 2AGYD 2J55L 3L4MC 2OK6D 4O1QC 2HKRD 4K3IC 3PXTC 4FA1C 1MG3B 2AGWD 4FB1C 2HXCD 2J57K 3SLEC 2OK4D
chains in the Genus database with same CATH superfamily
4FANC 2OJYD 4L3HC 2IURD 2HJ4D 2AGXD 3SJLC 3SVWC 1MAFL 2AGZD 2BBKL 1MG2B 2IUPD 2GC4B 2AH0D 2IUQD 3PXWC 3RN0C 2AGLD 4Y5RC 2H3XB 4L3GC 4L1QC 3SWSC 2IUVD 2AH1D 4FAVC 3RN1C 2MTAL 2HJBD 2I0RD 3C75L 2OIZD 4FA5C 4FA9C 2H47B 1MAEL 1MDAL 2J56L 3RLMC 2IAAB 3L4OC 3SXTC 3ORVC 2HKMD 2MADL 2Q7QD 2I0TD 3PXSC 3RMZC 2GC7B 4FA4C 2I0SD 2AGYD 2J55L 3L4MC 2OK6D 4O1QC 2HKRD 4K3IC 3PXTC 4FA1C 1MG3B 2AGWD 4FB1C 2HXCD 2J57K 3SLEC 2OK4D
chains in the Genus database with same CATH topology
4FANC 2OJYD 4L3HC 2IURD 2HJ4D 2AGXD 3SJLC 3SVWC 1MAFL 2AGZD 2BBKL 1MG2B 2IUPD 2GC4B 2AH0D 2IUQD 3PXWC 3RN0C 2AGLD 4Y5RC 2H3XB 4L3GC 4L1QC 3SWSC 2IUVD 2AH1D 4FAVC 3RN1C 2MTAL 2HJBD 2I0RD 3C75L 2OIZD 4FA5C 4FA9C 2H47B 1MAEL 1MDAL 2J56L 3RLMC 2IAAB 3L4OC 3SXTC 3ORVC 2HKMD 2MADL 2Q7QD 2I0TD 3PXSC 3RMZC 2GC7B 4FA4C 2I0SD 2AGYD 2J55L 3L4MC 2OK6D 4O1QC 2HKRD 4K3IC 3PXTC 4FA1C 1MG3B 2AGWD 4FB1C 2HXCD 2J57K 3SLEC 2OK4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAN C;  2OJY D;  4L3H C;  2IUR D;  2HJ4 D;  2AGX D;  3SJL C;  3SVW C;  1MAF L;  2AGZ D;  2BBK L;  1MG2 B;  2IUP D;  2GC4 B;  2AH0 D;  2IUQ D;  3PXW C;  3RN0 C;  2AGL D;  4Y5R C;  2H3X B;  4L3G C;  4L1Q C;  3SWS C;  2IUV D;  2AH1 D;  4FAV C;  3RN1 C;  2MTA L;  2HJB D;  2I0R D;  3C75 L;  2OIZ D;  4FA5 C;  4FA9 C;  2H47 B;  1MAE L;  1MDA L;  2J56 L;  3RLM C;  2IAA B;  3L4O C;  3SXT C;  3ORV C;  2HKM D;  2MAD L;  2Q7Q D;  2I0T D;  3PXS C;  3RMZ C;  2GC7 B;  4FA4 C;  2I0S D;  2AGY D;  2J55 L;  3L4M C;  2OK6 D;  4O1Q C;  2HKR D;  4K3I C;  3PXT C;  4FA1 C;  1MG3 B;  2AGW D;  4FB1 C;  2HXC D;  2J57 K;  3SLE C;  2OK4 D; 
#chains in the Genus database with same CATH topology
 4FAN C;  2OJY D;  4L3H C;  2IUR D;  2HJ4 D;  2AGX D;  3SJL C;  3SVW C;  1MAF L;  2AGZ D;  2BBK L;  1MG2 B;  2IUP D;  2GC4 B;  2AH0 D;  2IUQ D;  3PXW C;  3RN0 C;  2AGL D;  4Y5R C;  2H3X B;  4L3G C;  4L1Q C;  3SWS C;  2IUV D;  2AH1 D;  4FAV C;  3RN1 C;  2MTA L;  2HJB D;  2I0R D;  3C75 L;  2OIZ D;  4FA5 C;  4FA9 C;  2H47 B;  1MAE L;  1MDA L;  2J56 L;  3RLM C;  2IAA B;  3L4O C;  3SXT C;  3ORV C;  2HKM D;  2MAD L;  2Q7Q D;  2I0T D;  3PXS C;  3RMZ C;  2GC7 B;  4FA4 C;  2I0S D;  2AGY D;  2J55 L;  3L4M C;  2OK6 D;  4O1Q C;  2HKR D;  4K3I C;  3PXT C;  4FA1 C;  1MG3 B;  2AGW D;  4FB1 C;  2HXC D;  2J57 K;  3SLE C;  2OK4 D; 
#chains in the Genus database with same CATH homology
 4FAN C;  2OJY D;  4L3H C;  2IUR D;  2HJ4 D;  2AGX D;  3SJL C;  3SVW C;  1MAF L;  2AGZ D;  2BBK L;  1MG2 B;  2IUP D;  2GC4 B;  2AH0 D;  2IUQ D;  3PXW C;  3RN0 C;  2AGL D;  4Y5R C;  2H3X B;  4L3G C;  4L1Q C;  3SWS C;  2IUV D;  2AH1 D;  4FAV C;  3RN1 C;  2MTA L;  2HJB D;  2I0R D;  3C75 L;  2OIZ D;  4FA5 C;  4FA9 C;  2H47 B;  1MAE L;  1MDA L;  2J56 L;  3RLM C;  2IAA B;  3L4O C;  3SXT C;  3ORV C;  2HKM D;  2MAD L;  2Q7Q D;  2I0T D;  3PXS C;  3RMZ C;  2GC7 B;  4FA4 C;  2I0S D;  2AGY D;  2J55 L;  3L4M C;  2OK6 D;  4O1Q C;  2HKR D;  4K3I C;  3PXT C;  4FA1 C;  1MG3 B;  2AGW D;  4FB1 C;  2HXC D;  2J57 K;  3SLE C;  2OK4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...