2J57K

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- quinol in complex with amicyanin.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 124
sequence length 125
chains with identical sequence L, M, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j57K00
4O1QC 4Y5RC 2OIZD 3SXTC 4FANC 4FA1C 2IUVD 1MAFL 3PXWC 2I0SD 4FAVC 3RLMC 2J57K 4L1QC 2I0RD 2HKRD 3RN1C 2BBKL 2OK6D 2IURD 3SJLC 2MADL 4FA9C 2J55L 4L3HC 2AGWD 2IUPD 3SWSC 2GC4B 2OJYD 2IUQD 2GC7B 1MDAL 2AGZD 2Q7QD 3RMZC 1MG3B 2AH1D 3PXTC 3RN0C 2HJBD 4FA4C 2HXCD 1MG2B 2H3XB 2MTAL 2J56L 1MAEL 3SVWC 3L4MC 3C75L 2AH0D 2IAAB 4L3GC 2AGYD 2H47B 3ORVC 2HJ4D 3PXSC 3L4OC 2HKMD 2AGXD 2I0TD 4K3IC 4FB1C 4FA5C 3SLEC 2AGLD 2OK4D
chains in the Genus database with same CATH superfamily
4O1QC 4Y5RC 2OIZD 3SXTC 4FANC 4FA1C 2IUVD 1MAFL 3PXWC 2I0SD 4FAVC 3RLMC 2J57K 4L1QC 2I0RD 2HKRD 3RN1C 2BBKL 2OK6D 2IURD 3SJLC 2MADL 4FA9C 2J55L 4L3HC 2AGWD 2IUPD 3SWSC 2GC4B 2OJYD 2IUQD 2GC7B 1MDAL 2AGZD 2Q7QD 3RMZC 1MG3B 2AH1D 3PXTC 3RN0C 2HJBD 4FA4C 2HXCD 1MG2B 2H3XB 2MTAL 2J56L 1MAEL 3SVWC 3L4MC 3C75L 2AH0D 2IAAB 4L3GC 2AGYD 2H47B 3ORVC 2HJ4D 3PXSC 3L4OC 2HKMD 2AGXD 2I0TD 4K3IC 4FB1C 4FA5C 3SLEC 2AGLD 2OK4D
chains in the Genus database with same CATH topology
4O1QC 4Y5RC 2OIZD 3SXTC 4FANC 4FA1C 2IUVD 1MAFL 3PXWC 2I0SD 4FAVC 3RLMC 2J57K 4L1QC 2I0RD 2HKRD 3RN1C 2BBKL 2OK6D 2IURD 3SJLC 2MADL 4FA9C 2J55L 4L3HC 2AGWD 2IUPD 3SWSC 2GC4B 2OJYD 2IUQD 2GC7B 1MDAL 2AGZD 2Q7QD 3RMZC 1MG3B 2AH1D 3PXTC 3RN0C 2HJBD 4FA4C 2HXCD 1MG2B 2H3XB 2MTAL 2J56L 1MAEL 3SVWC 3L4MC 3C75L 2AH0D 2IAAB 4L3GC 2AGYD 2H47B 3ORVC 2HJ4D 3PXSC 3L4OC 2HKMD 2AGXD 2I0TD 4K3IC 4FB1C 4FA5C 3SLEC 2AGLD 2OK4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O1Q C;  4Y5R C;  2OIZ D;  3SXT C;  4FAN C;  4FA1 C;  2IUV D;  1MAF L;  3PXW C;  2I0S D;  4FAV C;  3RLM C;  2J57 K;  4L1Q C;  2I0R D;  2HKR D;  3RN1 C;  2BBK L;  2OK6 D;  2IUR D;  3SJL C;  2MAD L;  4FA9 C;  2J55 L;  4L3H C;  2AGW D;  2IUP D;  3SWS C;  2GC4 B;  2OJY D;  2IUQ D;  2GC7 B;  1MDA L;  2AGZ D;  2Q7Q D;  3RMZ C;  1MG3 B;  2AH1 D;  3PXT C;  3RN0 C;  2HJB D;  4FA4 C;  2HXC D;  1MG2 B;  2H3X B;  2MTA L;  2J56 L;  1MAE L;  3SVW C;  3L4M C;  3C75 L;  2AH0 D;  2IAA B;  4L3G C;  2AGY D;  2H47 B;  3ORV C;  2HJ4 D;  3PXS C;  3L4O C;  2HKM D;  2AGX D;  2I0T D;  4K3I C;  4FB1 C;  4FA5 C;  3SLE C;  2AGL D;  2OK4 D; 
#chains in the Genus database with same CATH topology
 4O1Q C;  4Y5R C;  2OIZ D;  3SXT C;  4FAN C;  4FA1 C;  2IUV D;  1MAF L;  3PXW C;  2I0S D;  4FAV C;  3RLM C;  2J57 K;  4L1Q C;  2I0R D;  2HKR D;  3RN1 C;  2BBK L;  2OK6 D;  2IUR D;  3SJL C;  2MAD L;  4FA9 C;  2J55 L;  4L3H C;  2AGW D;  2IUP D;  3SWS C;  2GC4 B;  2OJY D;  2IUQ D;  2GC7 B;  1MDA L;  2AGZ D;  2Q7Q D;  3RMZ C;  1MG3 B;  2AH1 D;  3PXT C;  3RN0 C;  2HJB D;  4FA4 C;  2HXC D;  1MG2 B;  2H3X B;  2MTA L;  2J56 L;  1MAE L;  3SVW C;  3L4M C;  3C75 L;  2AH0 D;  2IAA B;  4L3G C;  2AGY D;  2H47 B;  3ORV C;  2HJ4 D;  3PXS C;  3L4O C;  2HKM D;  2AGX D;  2I0T D;  4K3I C;  4FB1 C;  4FA5 C;  3SLE C;  2AGL D;  2OK4 D; 
#chains in the Genus database with same CATH homology
 4O1Q C;  4Y5R C;  2OIZ D;  3SXT C;  4FAN C;  4FA1 C;  2IUV D;  1MAF L;  3PXW C;  2I0S D;  4FAV C;  3RLM C;  2J57 K;  4L1Q C;  2I0R D;  2HKR D;  3RN1 C;  2BBK L;  2OK6 D;  2IUR D;  3SJL C;  2MAD L;  4FA9 C;  2J55 L;  4L3H C;  2AGW D;  2IUP D;  3SWS C;  2GC4 B;  2OJY D;  2IUQ D;  2GC7 B;  1MDA L;  2AGZ D;  2Q7Q D;  3RMZ C;  1MG3 B;  2AH1 D;  3PXT C;  3RN0 C;  2HJB D;  4FA4 C;  2HXC D;  1MG2 B;  2H3X B;  2MTA L;  2J56 L;  1MAE L;  3SVW C;  3L4M C;  3C75 L;  2AH0 D;  2IAA B;  4L3G C;  2AGY D;  2H47 B;  3ORV C;  2HJ4 D;  3PXS C;  3L4O C;  2HKM D;  2AGX D;  2I0T D;  4K3I C;  4FB1 C;  4FA5 C;  3SLE C;  2AGL D;  2OK4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...