2AH1D

Crystal structure of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ah1D00
2AH0D 1MG3B 4L1QC 4L3GC 2H47B 2I0RD 3SLEC 2GC4B 1MAFL 2J56L 3RN1C 4FANC 2AGXD 3RLMC 3C75L 3L4MC 4Y5RC 2IUVD 4FB1C 2HKRD 1MDAL 2I0TD 2J55L 2IUPD 2MTAL 2AGYD 2Q7QD 3RN0C 4FA4C 2OK6D 4L3HC 2IUQD 2GC7B 1MAEL 2AGZD 2HJBD 2HJ4D 2IURD 3PXSC 2OK4D 3SWSC 3ORVC 3PXWC 4K3IC 4O1QC 2IAAB 2BBKL 1MG2B 2MADL 2OJYD 3SJLC 2HKMD 3SXTC 4FAVC 3SVWC 3PXTC 4FA9C 2AH1D 2I0SD 3RMZC 4FA5C 2J57K 2OIZD 2AGLD 2HXCD 3L4OC 4FA1C 2AGWD 2H3XB
chains in the Genus database with same CATH superfamily
2AH0D 1MG3B 4L1QC 4L3GC 2H47B 2I0RD 3SLEC 2GC4B 1MAFL 2J56L 3RN1C 4FANC 2AGXD 3RLMC 3C75L 3L4MC 4Y5RC 2IUVD 4FB1C 2HKRD 1MDAL 2I0TD 2J55L 2IUPD 2MTAL 2AGYD 2Q7QD 3RN0C 4FA4C 2OK6D 4L3HC 2IUQD 2GC7B 1MAEL 2AGZD 2HJBD 2HJ4D 2IURD 3PXSC 2OK4D 3SWSC 3ORVC 3PXWC 4K3IC 4O1QC 2IAAB 2BBKL 1MG2B 2MADL 2OJYD 3SJLC 2HKMD 3SXTC 4FAVC 3SVWC 3PXTC 4FA9C 2AH1D 2I0SD 3RMZC 4FA5C 2J57K 2OIZD 2AGLD 2HXCD 3L4OC 4FA1C 2AGWD 2H3XB
chains in the Genus database with same CATH topology
2AH0D 1MG3B 4L1QC 4L3GC 2H47B 2I0RD 3SLEC 2GC4B 1MAFL 2J56L 3RN1C 4FANC 2AGXD 3RLMC 3C75L 3L4MC 4Y5RC 2IUVD 4FB1C 2HKRD 1MDAL 2I0TD 2J55L 2IUPD 2MTAL 2AGYD 2Q7QD 3RN0C 4FA4C 2OK6D 4L3HC 2IUQD 2GC7B 1MAEL 2AGZD 2HJBD 2HJ4D 2IURD 3PXSC 2OK4D 3SWSC 3ORVC 3PXWC 4K3IC 4O1QC 2IAAB 2BBKL 1MG2B 2MADL 2OJYD 3SJLC 2HKMD 3SXTC 4FAVC 3SVWC 3PXTC 4FA9C 2AH1D 2I0SD 3RMZC 4FA5C 2J57K 2OIZD 2AGLD 2HXCD 3L4OC 4FA1C 2AGWD 2H3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH0 D;  1MG3 B;  4L1Q C;  4L3G C;  2H47 B;  2I0R D;  3SLE C;  2GC4 B;  1MAF L;  2J56 L;  3RN1 C;  4FAN C;  2AGX D;  3RLM C;  3C75 L;  3L4M C;  4Y5R C;  2IUV D;  4FB1 C;  2HKR D;  1MDA L;  2I0T D;  2J55 L;  2IUP D;  2MTA L;  2AGY D;  2Q7Q D;  3RN0 C;  4FA4 C;  2OK6 D;  4L3H C;  2IUQ D;  2GC7 B;  1MAE L;  2AGZ D;  2HJB D;  2HJ4 D;  2IUR D;  3PXS C;  2OK4 D;  3SWS C;  3ORV C;  3PXW C;  4K3I C;  4O1Q C;  2IAA B;  2BBK L;  1MG2 B;  2MAD L;  2OJY D;  3SJL C;  2HKM D;  3SXT C;  4FAV C;  3SVW C;  3PXT C;  4FA9 C;  2AH1 D;  2I0S D;  3RMZ C;  4FA5 C;  2J57 K;  2OIZ D;  2AGL D;  2HXC D;  3L4O C;  4FA1 C;  2AGW D;  2H3X B; 
#chains in the Genus database with same CATH topology
 2AH0 D;  1MG3 B;  4L1Q C;  4L3G C;  2H47 B;  2I0R D;  3SLE C;  2GC4 B;  1MAF L;  2J56 L;  3RN1 C;  4FAN C;  2AGX D;  3RLM C;  3C75 L;  3L4M C;  4Y5R C;  2IUV D;  4FB1 C;  2HKR D;  1MDA L;  2I0T D;  2J55 L;  2IUP D;  2MTA L;  2AGY D;  2Q7Q D;  3RN0 C;  4FA4 C;  2OK6 D;  4L3H C;  2IUQ D;  2GC7 B;  1MAE L;  2AGZ D;  2HJB D;  2HJ4 D;  2IUR D;  3PXS C;  2OK4 D;  3SWS C;  3ORV C;  3PXW C;  4K3I C;  4O1Q C;  2IAA B;  2BBK L;  1MG2 B;  2MAD L;  2OJY D;  3SJL C;  2HKM D;  3SXT C;  4FAV C;  3SVW C;  3PXT C;  4FA9 C;  2AH1 D;  2I0S D;  3RMZ C;  4FA5 C;  2J57 K;  2OIZ D;  2AGL D;  2HXC D;  3L4O C;  4FA1 C;  2AGW D;  2H3X B; 
#chains in the Genus database with same CATH homology
 2AH0 D;  1MG3 B;  4L1Q C;  4L3G C;  2H47 B;  2I0R D;  3SLE C;  2GC4 B;  1MAF L;  2J56 L;  3RN1 C;  4FAN C;  2AGX D;  3RLM C;  3C75 L;  3L4M C;  4Y5R C;  2IUV D;  4FB1 C;  2HKR D;  1MDA L;  2I0T D;  2J55 L;  2IUP D;  2MTA L;  2AGY D;  2Q7Q D;  3RN0 C;  4FA4 C;  2OK6 D;  4L3H C;  2IUQ D;  2GC7 B;  1MAE L;  2AGZ D;  2HJB D;  2HJ4 D;  2IUR D;  3PXS C;  2OK4 D;  3SWS C;  3ORV C;  3PXW C;  4K3I C;  4O1Q C;  2IAA B;  2BBK L;  1MG2 B;  2MAD L;  2OJY D;  3SJL C;  2HKM D;  3SXT C;  4FAV C;  3SVW C;  3PXT C;  4FA9 C;  2AH1 D;  2I0S D;  3RMZ C;  4FA5 C;  2J57 K;  2OIZ D;  2AGL D;  2HXC D;  3L4O C;  4FA1 C;  2AGW D;  2H3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...