2AGYD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agyD00
2AH1D 2AGWD 2IURD 2H47B 2IAAB 2HKMD 4K3IC 4O1QC 2IUVD 4L1QC 3RLMC 2Q7QD 3SLEC 3PXSC 2I0RD 4FA5C 2GC4B 3ORVC 1MAEL 2AGYD 3L4MC 2BBKL 4L3GC 2J56L 2I0SD 4FANC 3RN1C 2J57K 2AGLD 2HJBD 2H3XB 3SVWC 4L3HC 4FB1C 4FAVC 2AH0D 4FA9C 2IUQD 2OJYD 3L4OC 2MTAL 3PXTC 4Y5RC 2AGXD 2OK4D 4FA4C 3RN0C 4FA1C 1MDAL 1MG3B 2HXCD 1MAFL 2J55L 3RMZC 2AGZD 2IUPD 1MG2B 2I0TD 2HJ4D 2GC7B 2HKRD 2MADL 2OK6D 3SJLC 3SXTC 3SWSC 3C75L 2OIZD 3PXWC
chains in the Genus database with same CATH superfamily
2AH1D 2AGWD 2IURD 2H47B 2IAAB 2HKMD 4K3IC 4O1QC 2IUVD 4L1QC 3RLMC 2Q7QD 3SLEC 3PXSC 2I0RD 4FA5C 2GC4B 3ORVC 1MAEL 2AGYD 3L4MC 2BBKL 4L3GC 2J56L 2I0SD 4FANC 3RN1C 2J57K 2AGLD 2HJBD 2H3XB 3SVWC 4L3HC 4FB1C 4FAVC 2AH0D 4FA9C 2IUQD 2OJYD 3L4OC 2MTAL 3PXTC 4Y5RC 2AGXD 2OK4D 4FA4C 3RN0C 4FA1C 1MDAL 1MG3B 2HXCD 1MAFL 2J55L 3RMZC 2AGZD 2IUPD 1MG2B 2I0TD 2HJ4D 2GC7B 2HKRD 2MADL 2OK6D 3SJLC 3SXTC 3SWSC 3C75L 2OIZD 3PXWC
chains in the Genus database with same CATH topology
2AH1D 2AGWD 2IURD 2H47B 2IAAB 2HKMD 4K3IC 4O1QC 2IUVD 4L1QC 3RLMC 2Q7QD 3SLEC 3PXSC 2I0RD 4FA5C 2GC4B 3ORVC 1MAEL 2AGYD 3L4MC 2BBKL 4L3GC 2J56L 2I0SD 4FANC 3RN1C 2J57K 2AGLD 2HJBD 2H3XB 3SVWC 4L3HC 4FB1C 4FAVC 2AH0D 4FA9C 2IUQD 2OJYD 3L4OC 2MTAL 3PXTC 4Y5RC 2AGXD 2OK4D 4FA4C 3RN0C 4FA1C 1MDAL 1MG3B 2HXCD 1MAFL 2J55L 3RMZC 2AGZD 2IUPD 1MG2B 2I0TD 2HJ4D 2GC7B 2HKRD 2MADL 2OK6D 3SJLC 3SXTC 3SWSC 3C75L 2OIZD 3PXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH1 D;  2AGW D;  2IUR D;  2H47 B;  2IAA B;  2HKM D;  4K3I C;  4O1Q C;  2IUV D;  4L1Q C;  3RLM C;  2Q7Q D;  3SLE C;  3PXS C;  2I0R D;  4FA5 C;  2GC4 B;  3ORV C;  1MAE L;  2AGY D;  3L4M C;  2BBK L;  4L3G C;  2J56 L;  2I0S D;  4FAN C;  3RN1 C;  2J57 K;  2AGL D;  2HJB D;  2H3X B;  3SVW C;  4L3H C;  4FB1 C;  4FAV C;  2AH0 D;  4FA9 C;  2IUQ D;  2OJY D;  3L4O C;  2MTA L;  3PXT C;  4Y5R C;  2AGX D;  2OK4 D;  4FA4 C;  3RN0 C;  4FA1 C;  1MDA L;  1MG3 B;  2HXC D;  1MAF L;  2J55 L;  3RMZ C;  2AGZ D;  2IUP D;  1MG2 B;  2I0T D;  2HJ4 D;  2GC7 B;  2HKR D;  2MAD L;  2OK6 D;  3SJL C;  3SXT C;  3SWS C;  3C75 L;  2OIZ D;  3PXW C; 
#chains in the Genus database with same CATH topology
 2AH1 D;  2AGW D;  2IUR D;  2H47 B;  2IAA B;  2HKM D;  4K3I C;  4O1Q C;  2IUV D;  4L1Q C;  3RLM C;  2Q7Q D;  3SLE C;  3PXS C;  2I0R D;  4FA5 C;  2GC4 B;  3ORV C;  1MAE L;  2AGY D;  3L4M C;  2BBK L;  4L3G C;  2J56 L;  2I0S D;  4FAN C;  3RN1 C;  2J57 K;  2AGL D;  2HJB D;  2H3X B;  3SVW C;  4L3H C;  4FB1 C;  4FAV C;  2AH0 D;  4FA9 C;  2IUQ D;  2OJY D;  3L4O C;  2MTA L;  3PXT C;  4Y5R C;  2AGX D;  2OK4 D;  4FA4 C;  3RN0 C;  4FA1 C;  1MDA L;  1MG3 B;  2HXC D;  1MAF L;  2J55 L;  3RMZ C;  2AGZ D;  2IUP D;  1MG2 B;  2I0T D;  2HJ4 D;  2GC7 B;  2HKR D;  2MAD L;  2OK6 D;  3SJL C;  3SXT C;  3SWS C;  3C75 L;  2OIZ D;  3PXW C; 
#chains in the Genus database with same CATH homology
 2AH1 D;  2AGW D;  2IUR D;  2H47 B;  2IAA B;  2HKM D;  4K3I C;  4O1Q C;  2IUV D;  4L1Q C;  3RLM C;  2Q7Q D;  3SLE C;  3PXS C;  2I0R D;  4FA5 C;  2GC4 B;  3ORV C;  1MAE L;  2AGY D;  3L4M C;  2BBK L;  4L3G C;  2J56 L;  2I0S D;  4FAN C;  3RN1 C;  2J57 K;  2AGL D;  2HJB D;  2H3X B;  3SVW C;  4L3H C;  4FB1 C;  4FAV C;  2AH0 D;  4FA9 C;  2IUQ D;  2OJY D;  3L4O C;  2MTA L;  3PXT C;  4Y5R C;  2AGX D;  2OK4 D;  4FA4 C;  3RN0 C;  4FA1 C;  1MDA L;  1MG3 B;  2HXC D;  1MAF L;  2J55 L;  3RMZ C;  2AGZ D;  2IUP D;  1MG2 B;  2I0T D;  2HJ4 D;  2GC7 B;  2HKR D;  2MAD L;  2OK6 D;  3SJL C;  3SXT C;  3SWS C;  3C75 L;  2OIZ D;  3PXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...