2AGYD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agyD00
2HJBD 2AGYD 4L3HC 4FA4C 3C75L 4FAVC 2IURD 2HKRD 1MAFL 2Q7QD 2MTAL 2I0TD 3SJLC 3SXTC 4Y5RC 4FA9C 2IUPD 4FA5C 3SVWC 1MG3B 2H3XB 3PXTC 2J55L 2IUVD 4L3GC 3RLMC 4FB1C 2IAAB 2H47B 2GC7B 4K3IC 3PXWC 2AGXD 2AGLD 2AH1D 2J56L 2OIZD 3ORVC 3RN1C 3L4MC 4L1QC 2AGWD 2OK6D 3RN0C 1MAEL 4FANC 2AH0D 2HJ4D 2BBKL 3PXSC 1MDAL 2HKMD 1MG2B 2GC4B 2IUQD 2MADL 3L4OC 2HXCD 2OK4D 4O1QC 4FA1C 3SWSC 2AGZD 2J57K 2OJYD 3RMZC 3SLEC 2I0RD 2I0SD
chains in the Genus database with same CATH superfamily
2HJBD 2AGYD 4L3HC 4FA4C 3C75L 4FAVC 2IURD 2HKRD 1MAFL 2Q7QD 2MTAL 2I0TD 3SJLC 3SXTC 4Y5RC 4FA9C 2IUPD 4FA5C 3SVWC 1MG3B 2H3XB 3PXTC 2J55L 2IUVD 4L3GC 3RLMC 4FB1C 2IAAB 2H47B 2GC7B 4K3IC 3PXWC 2AGXD 2AGLD 2AH1D 2J56L 2OIZD 3ORVC 3RN1C 3L4MC 4L1QC 2AGWD 2OK6D 3RN0C 1MAEL 4FANC 2AH0D 2HJ4D 2BBKL 3PXSC 1MDAL 2HKMD 1MG2B 2GC4B 2IUQD 2MADL 3L4OC 2HXCD 2OK4D 4O1QC 4FA1C 3SWSC 2AGZD 2J57K 2OJYD 3RMZC 3SLEC 2I0RD 2I0SD
chains in the Genus database with same CATH topology
2HJBD 2AGYD 4L3HC 4FA4C 3C75L 4FAVC 2IURD 2HKRD 1MAFL 2Q7QD 2MTAL 2I0TD 3SJLC 3SXTC 4Y5RC 4FA9C 2IUPD 4FA5C 3SVWC 1MG3B 2H3XB 3PXTC 2J55L 2IUVD 4L3GC 3RLMC 4FB1C 2IAAB 2H47B 2GC7B 4K3IC 3PXWC 2AGXD 2AGLD 2AH1D 2J56L 2OIZD 3ORVC 3RN1C 3L4MC 4L1QC 2AGWD 2OK6D 3RN0C 1MAEL 4FANC 2AH0D 2HJ4D 2BBKL 3PXSC 1MDAL 2HKMD 1MG2B 2GC4B 2IUQD 2MADL 3L4OC 2HXCD 2OK4D 4O1QC 4FA1C 3SWSC 2AGZD 2J57K 2OJYD 3RMZC 3SLEC 2I0RD 2I0SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJB D;  2AGY D;  4L3H C;  4FA4 C;  3C75 L;  4FAV C;  2IUR D;  2HKR D;  1MAF L;  2Q7Q D;  2MTA L;  2I0T D;  3SJL C;  3SXT C;  4Y5R C;  4FA9 C;  2IUP D;  4FA5 C;  3SVW C;  1MG3 B;  2H3X B;  3PXT C;  2J55 L;  2IUV D;  4L3G C;  3RLM C;  4FB1 C;  2IAA B;  2H47 B;  2GC7 B;  4K3I C;  3PXW C;  2AGX D;  2AGL D;  2AH1 D;  2J56 L;  2OIZ D;  3ORV C;  3RN1 C;  3L4M C;  4L1Q C;  2AGW D;  2OK6 D;  3RN0 C;  1MAE L;  4FAN C;  2AH0 D;  2HJ4 D;  2BBK L;  3PXS C;  1MDA L;  2HKM D;  1MG2 B;  2GC4 B;  2IUQ D;  2MAD L;  3L4O C;  2HXC D;  2OK4 D;  4O1Q C;  4FA1 C;  3SWS C;  2AGZ D;  2J57 K;  2OJY D;  3RMZ C;  3SLE C;  2I0R D;  2I0S D; 
#chains in the Genus database with same CATH topology
 2HJB D;  2AGY D;  4L3H C;  4FA4 C;  3C75 L;  4FAV C;  2IUR D;  2HKR D;  1MAF L;  2Q7Q D;  2MTA L;  2I0T D;  3SJL C;  3SXT C;  4Y5R C;  4FA9 C;  2IUP D;  4FA5 C;  3SVW C;  1MG3 B;  2H3X B;  3PXT C;  2J55 L;  2IUV D;  4L3G C;  3RLM C;  4FB1 C;  2IAA B;  2H47 B;  2GC7 B;  4K3I C;  3PXW C;  2AGX D;  2AGL D;  2AH1 D;  2J56 L;  2OIZ D;  3ORV C;  3RN1 C;  3L4M C;  4L1Q C;  2AGW D;  2OK6 D;  3RN0 C;  1MAE L;  4FAN C;  2AH0 D;  2HJ4 D;  2BBK L;  3PXS C;  1MDA L;  2HKM D;  1MG2 B;  2GC4 B;  2IUQ D;  2MAD L;  3L4O C;  2HXC D;  2OK4 D;  4O1Q C;  4FA1 C;  3SWS C;  2AGZ D;  2J57 K;  2OJY D;  3RMZ C;  3SLE C;  2I0R D;  2I0S D; 
#chains in the Genus database with same CATH homology
 2HJB D;  2AGY D;  4L3H C;  4FA4 C;  3C75 L;  4FAV C;  2IUR D;  2HKR D;  1MAF L;  2Q7Q D;  2MTA L;  2I0T D;  3SJL C;  3SXT C;  4Y5R C;  4FA9 C;  2IUP D;  4FA5 C;  3SVW C;  1MG3 B;  2H3X B;  3PXT C;  2J55 L;  2IUV D;  4L3G C;  3RLM C;  4FB1 C;  2IAA B;  2H47 B;  2GC7 B;  4K3I C;  3PXW C;  2AGX D;  2AGL D;  2AH1 D;  2J56 L;  2OIZ D;  3ORV C;  3RN1 C;  3L4M C;  4L1Q C;  2AGW D;  2OK6 D;  3RN0 C;  1MAE L;  4FAN C;  2AH0 D;  2HJ4 D;  2BBK L;  3PXS C;  1MDA L;  2HKM D;  1MG2 B;  2GC4 B;  2IUQ D;  2MAD L;  3L4O C;  2HXC D;  2OK4 D;  4O1Q C;  4FA1 C;  3SWS C;  2AGZ D;  2J57 K;  2OJY D;  3RMZ C;  3SLE C;  2I0R D;  2I0S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...