3L4OC

Crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein mauG
publication title In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3l4oC00
2AGYD 3RLMC 2MTAL 2HKMD 4K3IC 2IUQD 2Q7QD 4FA4C 4FA5C 4FA1C 2OIZD 2HJBD 4O1QC 3SLEC 2HKRD 2BBKL 2AGZD 1MG3B 3SVWC 2IURD 3ORVC 2AH1D 3SJLC 4L1QC 2H47B 2AH0D 4FANC 2AGXD 3RN0C 2IUPD 3RMZC 3L4OC 3PXWC 4FAVC 4FA9C 2OK6D 3C75L 3PXSC 1MG2B 4L3GC 2J56L 2I0SD 2HJ4D 2I0TD 3SWSC 3SXTC 3RN1C 2GC7B 2MADL 3L4MC 2H3XB 2AGLD 1MAEL 1MDAL 2J55L 4L3HC 2GC4B 2IAAB 2OJYD 3PXTC 4Y5RC 4FB1C 2OK4D 1MAFL 2IUVD 2HXCD 2J57K 2AGWD 2I0RD
chains in the Genus database with same CATH superfamily
2AGYD 3RLMC 2MTAL 2HKMD 4K3IC 2IUQD 2Q7QD 4FA4C 4FA5C 4FA1C 2OIZD 2HJBD 4O1QC 3SLEC 2HKRD 2BBKL 2AGZD 1MG3B 3SVWC 2IURD 3ORVC 2AH1D 3SJLC 4L1QC 2H47B 2AH0D 4FANC 2AGXD 3RN0C 2IUPD 3RMZC 3L4OC 3PXWC 4FAVC 4FA9C 2OK6D 3C75L 3PXSC 1MG2B 4L3GC 2J56L 2I0SD 2HJ4D 2I0TD 3SWSC 3SXTC 3RN1C 2GC7B 2MADL 3L4MC 2H3XB 2AGLD 1MAEL 1MDAL 2J55L 4L3HC 2GC4B 2IAAB 2OJYD 3PXTC 4Y5RC 4FB1C 2OK4D 1MAFL 2IUVD 2HXCD 2J57K 2AGWD 2I0RD
chains in the Genus database with same CATH topology
2AGYD 3RLMC 2MTAL 2HKMD 4K3IC 2IUQD 2Q7QD 4FA4C 4FA5C 4FA1C 2OIZD 2HJBD 4O1QC 3SLEC 2HKRD 2BBKL 2AGZD 1MG3B 3SVWC 2IURD 3ORVC 2AH1D 3SJLC 4L1QC 2H47B 2AH0D 4FANC 2AGXD 3RN0C 2IUPD 3RMZC 3L4OC 3PXWC 4FAVC 4FA9C 2OK6D 3C75L 3PXSC 1MG2B 4L3GC 2J56L 2I0SD 2HJ4D 2I0TD 3SWSC 3SXTC 3RN1C 2GC7B 2MADL 3L4MC 2H3XB 2AGLD 1MAEL 1MDAL 2J55L 4L3HC 2GC4B 2IAAB 2OJYD 3PXTC 4Y5RC 4FB1C 2OK4D 1MAFL 2IUVD 2HXCD 2J57K 2AGWD 2I0RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGY D;  3RLM C;  2MTA L;  2HKM D;  4K3I C;  2IUQ D;  2Q7Q D;  4FA4 C;  4FA5 C;  4FA1 C;  2OIZ D;  2HJB D;  4O1Q C;  3SLE C;  2HKR D;  2BBK L;  2AGZ D;  1MG3 B;  3SVW C;  2IUR D;  3ORV C;  2AH1 D;  3SJL C;  4L1Q C;  2H47 B;  2AH0 D;  4FAN C;  2AGX D;  3RN0 C;  2IUP D;  3RMZ C;  3L4O C;  3PXW C;  4FAV C;  4FA9 C;  2OK6 D;  3C75 L;  3PXS C;  1MG2 B;  4L3G C;  2J56 L;  2I0S D;  2HJ4 D;  2I0T D;  3SWS C;  3SXT C;  3RN1 C;  2GC7 B;  2MAD L;  3L4M C;  2H3X B;  2AGL D;  1MAE L;  1MDA L;  2J55 L;  4L3H C;  2GC4 B;  2IAA B;  2OJY D;  3PXT C;  4Y5R C;  4FB1 C;  2OK4 D;  1MAF L;  2IUV D;  2HXC D;  2J57 K;  2AGW D;  2I0R D; 
#chains in the Genus database with same CATH topology
 2AGY D;  3RLM C;  2MTA L;  2HKM D;  4K3I C;  2IUQ D;  2Q7Q D;  4FA4 C;  4FA5 C;  4FA1 C;  2OIZ D;  2HJB D;  4O1Q C;  3SLE C;  2HKR D;  2BBK L;  2AGZ D;  1MG3 B;  3SVW C;  2IUR D;  3ORV C;  2AH1 D;  3SJL C;  4L1Q C;  2H47 B;  2AH0 D;  4FAN C;  2AGX D;  3RN0 C;  2IUP D;  3RMZ C;  3L4O C;  3PXW C;  4FAV C;  4FA9 C;  2OK6 D;  3C75 L;  3PXS C;  1MG2 B;  4L3G C;  2J56 L;  2I0S D;  2HJ4 D;  2I0T D;  3SWS C;  3SXT C;  3RN1 C;  2GC7 B;  2MAD L;  3L4M C;  2H3X B;  2AGL D;  1MAE L;  1MDA L;  2J55 L;  4L3H C;  2GC4 B;  2IAA B;  2OJY D;  3PXT C;  4Y5R C;  4FB1 C;  2OK4 D;  1MAF L;  2IUV D;  2HXC D;  2J57 K;  2AGW D;  2I0R D; 
#chains in the Genus database with same CATH homology
 2AGY D;  3RLM C;  2MTA L;  2HKM D;  4K3I C;  2IUQ D;  2Q7Q D;  4FA4 C;  4FA5 C;  4FA1 C;  2OIZ D;  2HJB D;  4O1Q C;  3SLE C;  2HKR D;  2BBK L;  2AGZ D;  1MG3 B;  3SVW C;  2IUR D;  3ORV C;  2AH1 D;  3SJL C;  4L1Q C;  2H47 B;  2AH0 D;  4FAN C;  2AGX D;  3RN0 C;  2IUP D;  3RMZ C;  3L4O C;  3PXW C;  4FAV C;  4FA9 C;  2OK6 D;  3C75 L;  3PXS C;  1MG2 B;  4L3G C;  2J56 L;  2I0S D;  2HJ4 D;  2I0T D;  3SWS C;  3SXT C;  3RN1 C;  2GC7 B;  2MAD L;  3L4M C;  2H3X B;  2AGL D;  1MAE L;  1MDA L;  2J55 L;  4L3H C;  2GC4 B;  2IAA B;  2OJY D;  3PXT C;  4Y5R C;  4FB1 C;  2OK4 D;  1MAF L;  2IUV D;  2HXC D;  2J57 K;  2AGW D;  2I0R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...