3L4OC

Crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein mauG
publication title In crystallo posttranslational modification within a MauG/pre-methylamine dehydrogenase complex.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3l4oC00
3SXTC 2OJYD 3RN0C 1MDAL 2AGLD 3RLMC 2MTAL 2IUQD 3SWSC 2HKMD 3ORVC 4O1QC 2AH0D 2GC7B 2I0TD 4Y5RC 4L3HC 4FA1C 4FA9C 3RN1C 2HXCD 4L3GC 3PXWC 2I0RD 2BBKL 3PXTC 2AGYD 4FAVC 2I0SD 4FB1C 2HKRD 2GC4B 3SLEC 2Q7QD 2MADL 4L1QC 3SJLC 1MAFL 2H47B 1MAEL 2HJ4D 2J55L 2OK6D 2OK4D 2IUVD 2IAAB 4FANC 2AGXD 2AGWD 2IUPD 3SVWC 2H3XB 2J56L 4FA5C 3RMZC 1MG2B 2OIZD 2HJBD 3L4OC 1MG3B 2AGZD 3C75L 3L4MC 4FA4C 2AH1D 2IURD 3PXSC 4K3IC 2J57K
chains in the Genus database with same CATH superfamily
3SXTC 2OJYD 3RN0C 1MDAL 2AGLD 3RLMC 2MTAL 2IUQD 3SWSC 2HKMD 3ORVC 4O1QC 2AH0D 2GC7B 2I0TD 4Y5RC 4L3HC 4FA1C 4FA9C 3RN1C 2HXCD 4L3GC 3PXWC 2I0RD 2BBKL 3PXTC 2AGYD 4FAVC 2I0SD 4FB1C 2HKRD 2GC4B 3SLEC 2Q7QD 2MADL 4L1QC 3SJLC 1MAFL 2H47B 1MAEL 2HJ4D 2J55L 2OK6D 2OK4D 2IUVD 2IAAB 4FANC 2AGXD 2AGWD 2IUPD 3SVWC 2H3XB 2J56L 4FA5C 3RMZC 1MG2B 2OIZD 2HJBD 3L4OC 1MG3B 2AGZD 3C75L 3L4MC 4FA4C 2AH1D 2IURD 3PXSC 4K3IC 2J57K
chains in the Genus database with same CATH topology
3SXTC 2OJYD 3RN0C 1MDAL 2AGLD 3RLMC 2MTAL 2IUQD 3SWSC 2HKMD 3ORVC 4O1QC 2AH0D 2GC7B 2I0TD 4Y5RC 4L3HC 4FA1C 4FA9C 3RN1C 2HXCD 4L3GC 3PXWC 2I0RD 2BBKL 3PXTC 2AGYD 4FAVC 2I0SD 4FB1C 2HKRD 2GC4B 3SLEC 2Q7QD 2MADL 4L1QC 3SJLC 1MAFL 2H47B 1MAEL 2HJ4D 2J55L 2OK6D 2OK4D 2IUVD 2IAAB 4FANC 2AGXD 2AGWD 2IUPD 3SVWC 2H3XB 2J56L 4FA5C 3RMZC 1MG2B 2OIZD 2HJBD 3L4OC 1MG3B 2AGZD 3C75L 3L4MC 4FA4C 2AH1D 2IURD 3PXSC 4K3IC 2J57K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXT C;  2OJY D;  3RN0 C;  1MDA L;  2AGL D;  3RLM C;  2MTA L;  2IUQ D;  3SWS C;  2HKM D;  3ORV C;  4O1Q C;  2AH0 D;  2GC7 B;  2I0T D;  4Y5R C;  4L3H C;  4FA1 C;  4FA9 C;  3RN1 C;  2HXC D;  4L3G C;  3PXW C;  2I0R D;  2BBK L;  3PXT C;  2AGY D;  4FAV C;  2I0S D;  4FB1 C;  2HKR D;  2GC4 B;  3SLE C;  2Q7Q D;  2MAD L;  4L1Q C;  3SJL C;  1MAF L;  2H47 B;  1MAE L;  2HJ4 D;  2J55 L;  2OK6 D;  2OK4 D;  2IUV D;  2IAA B;  4FAN C;  2AGX D;  2AGW D;  2IUP D;  3SVW C;  2H3X B;  2J56 L;  4FA5 C;  3RMZ C;  1MG2 B;  2OIZ D;  2HJB D;  3L4O C;  1MG3 B;  2AGZ D;  3C75 L;  3L4M C;  4FA4 C;  2AH1 D;  2IUR D;  3PXS C;  4K3I C;  2J57 K; 
#chains in the Genus database with same CATH topology
 3SXT C;  2OJY D;  3RN0 C;  1MDA L;  2AGL D;  3RLM C;  2MTA L;  2IUQ D;  3SWS C;  2HKM D;  3ORV C;  4O1Q C;  2AH0 D;  2GC7 B;  2I0T D;  4Y5R C;  4L3H C;  4FA1 C;  4FA9 C;  3RN1 C;  2HXC D;  4L3G C;  3PXW C;  2I0R D;  2BBK L;  3PXT C;  2AGY D;  4FAV C;  2I0S D;  4FB1 C;  2HKR D;  2GC4 B;  3SLE C;  2Q7Q D;  2MAD L;  4L1Q C;  3SJL C;  1MAF L;  2H47 B;  1MAE L;  2HJ4 D;  2J55 L;  2OK6 D;  2OK4 D;  2IUV D;  2IAA B;  4FAN C;  2AGX D;  2AGW D;  2IUP D;  3SVW C;  2H3X B;  2J56 L;  4FA5 C;  3RMZ C;  1MG2 B;  2OIZ D;  2HJB D;  3L4O C;  1MG3 B;  2AGZ D;  3C75 L;  3L4M C;  4FA4 C;  2AH1 D;  2IUR D;  3PXS C;  4K3I C;  2J57 K; 
#chains in the Genus database with same CATH homology
 3SXT C;  2OJY D;  3RN0 C;  1MDA L;  2AGL D;  3RLM C;  2MTA L;  2IUQ D;  3SWS C;  2HKM D;  3ORV C;  4O1Q C;  2AH0 D;  2GC7 B;  2I0T D;  4Y5R C;  4L3H C;  4FA1 C;  4FA9 C;  3RN1 C;  2HXC D;  4L3G C;  3PXW C;  2I0R D;  2BBK L;  3PXT C;  2AGY D;  4FAV C;  2I0S D;  4FB1 C;  2HKR D;  2GC4 B;  3SLE C;  2Q7Q D;  2MAD L;  4L1Q C;  3SJL C;  1MAF L;  2H47 B;  1MAE L;  2HJ4 D;  2J55 L;  2OK6 D;  2OK4 D;  2IUV D;  2IAA B;  4FAN C;  2AGX D;  2AGW D;  2IUP D;  3SVW C;  2H3X B;  2J56 L;  4FA5 C;  3RMZ C;  1MG2 B;  2OIZ D;  2HJB D;  3L4O C;  1MG3 B;  2AGZ D;  3C75 L;  3L4M C;  4FA4 C;  2AH1 D;  2IUR D;  3PXS C;  4K3I C;  2J57 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...