4FA5C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 20 days
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa5C00
4L3HC 3L4OC 2IURD 3SXTC 2H3XB 4O1QC 2IAAB 3ORVC 3PXSC 1MDAL 3C75L 3RLMC 3RN0C 3SJLC 4FAVC 1MAEL 4L3GC 2AGXD 2HXCD 1MG3B 2I0SD 2AGYD 2AGZD 2OIZD 4K3IC 2AGLD 4FA1C 2J55L 2AH1D 2IUQD 4FB1C 2GC4B 2AGWD 2IUPD 2J57K 2HJBD 2MADL 3PXWC 2J56L 3SVWC 2HJ4D 2I0RD 4FA9C 4FANC 3L4MC 3RN1C 2HKRD 4FA5C 2I0TD 1MAFL 2HKMD 4Y5RC 2OJYD 4L1QC 2H47B 3RMZC 2MTAL 1MG2B 2GC7B 2BBKL 3PXTC 2OK4D 3SLEC 2OK6D 4FA4C 2AH0D 2Q7QD 2IUVD 3SWSC
chains in the Genus database with same CATH superfamily
4L3HC 3L4OC 2IURD 3SXTC 2H3XB 4O1QC 2IAAB 3ORVC 3PXSC 1MDAL 3C75L 3RLMC 3RN0C 3SJLC 4FAVC 1MAEL 4L3GC 2AGXD 2HXCD 1MG3B 2I0SD 2AGYD 2AGZD 2OIZD 4K3IC 2AGLD 4FA1C 2J55L 2AH1D 2IUQD 4FB1C 2GC4B 2AGWD 2IUPD 2J57K 2HJBD 2MADL 3PXWC 2J56L 3SVWC 2HJ4D 2I0RD 4FA9C 4FANC 3L4MC 3RN1C 2HKRD 4FA5C 2I0TD 1MAFL 2HKMD 4Y5RC 2OJYD 4L1QC 2H47B 3RMZC 2MTAL 1MG2B 2GC7B 2BBKL 3PXTC 2OK4D 3SLEC 2OK6D 4FA4C 2AH0D 2Q7QD 2IUVD 3SWSC
chains in the Genus database with same CATH topology
4L3HC 3L4OC 2IURD 3SXTC 2H3XB 4O1QC 2IAAB 3ORVC 3PXSC 1MDAL 3C75L 3RLMC 3RN0C 3SJLC 4FAVC 1MAEL 4L3GC 2AGXD 2HXCD 1MG3B 2I0SD 2AGYD 2AGZD 2OIZD 4K3IC 2AGLD 4FA1C 2J55L 2AH1D 2IUQD 4FB1C 2GC4B 2AGWD 2IUPD 2J57K 2HJBD 2MADL 3PXWC 2J56L 3SVWC 2HJ4D 2I0RD 4FA9C 4FANC 3L4MC 3RN1C 2HKRD 4FA5C 2I0TD 1MAFL 2HKMD 4Y5RC 2OJYD 4L1QC 2H47B 3RMZC 2MTAL 1MG2B 2GC7B 2BBKL 3PXTC 2OK4D 3SLEC 2OK6D 4FA4C 2AH0D 2Q7QD 2IUVD 3SWSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3H C;  3L4O C;  2IUR D;  3SXT C;  2H3X B;  4O1Q C;  2IAA B;  3ORV C;  3PXS C;  1MDA L;  3C75 L;  3RLM C;  3RN0 C;  3SJL C;  4FAV C;  1MAE L;  4L3G C;  2AGX D;  2HXC D;  1MG3 B;  2I0S D;  2AGY D;  2AGZ D;  2OIZ D;  4K3I C;  2AGL D;  4FA1 C;  2J55 L;  2AH1 D;  2IUQ D;  4FB1 C;  2GC4 B;  2AGW D;  2IUP D;  2J57 K;  2HJB D;  2MAD L;  3PXW C;  2J56 L;  3SVW C;  2HJ4 D;  2I0R D;  4FA9 C;  4FAN C;  3L4M C;  3RN1 C;  2HKR D;  4FA5 C;  2I0T D;  1MAF L;  2HKM D;  4Y5R C;  2OJY D;  4L1Q C;  2H47 B;  3RMZ C;  2MTA L;  1MG2 B;  2GC7 B;  2BBK L;  3PXT C;  2OK4 D;  3SLE C;  2OK6 D;  4FA4 C;  2AH0 D;  2Q7Q D;  2IUV D;  3SWS C; 
#chains in the Genus database with same CATH topology
 4L3H C;  3L4O C;  2IUR D;  3SXT C;  2H3X B;  4O1Q C;  2IAA B;  3ORV C;  3PXS C;  1MDA L;  3C75 L;  3RLM C;  3RN0 C;  3SJL C;  4FAV C;  1MAE L;  4L3G C;  2AGX D;  2HXC D;  1MG3 B;  2I0S D;  2AGY D;  2AGZ D;  2OIZ D;  4K3I C;  2AGL D;  4FA1 C;  2J55 L;  2AH1 D;  2IUQ D;  4FB1 C;  2GC4 B;  2AGW D;  2IUP D;  2J57 K;  2HJB D;  2MAD L;  3PXW C;  2J56 L;  3SVW C;  2HJ4 D;  2I0R D;  4FA9 C;  4FAN C;  3L4M C;  3RN1 C;  2HKR D;  4FA5 C;  2I0T D;  1MAF L;  2HKM D;  4Y5R C;  2OJY D;  4L1Q C;  2H47 B;  3RMZ C;  2MTA L;  1MG2 B;  2GC7 B;  2BBK L;  3PXT C;  2OK4 D;  3SLE C;  2OK6 D;  4FA4 C;  2AH0 D;  2Q7Q D;  2IUV D;  3SWS C; 
#chains in the Genus database with same CATH homology
 4L3H C;  3L4O C;  2IUR D;  3SXT C;  2H3X B;  4O1Q C;  2IAA B;  3ORV C;  3PXS C;  1MDA L;  3C75 L;  3RLM C;  3RN0 C;  3SJL C;  4FAV C;  1MAE L;  4L3G C;  2AGX D;  2HXC D;  1MG3 B;  2I0S D;  2AGY D;  2AGZ D;  2OIZ D;  4K3I C;  2AGL D;  4FA1 C;  2J55 L;  2AH1 D;  2IUQ D;  4FB1 C;  2GC4 B;  2AGW D;  2IUP D;  2J57 K;  2HJB D;  2MAD L;  3PXW C;  2J56 L;  3SVW C;  2HJ4 D;  2I0R D;  4FA9 C;  4FAN C;  3L4M C;  3RN1 C;  2HKR D;  4FA5 C;  2I0T D;  1MAF L;  2HKM D;  4Y5R C;  2OJY D;  4L1Q C;  2H47 B;  3RMZ C;  2MTA L;  1MG2 B;  2GC7 B;  2BBK L;  3PXT C;  2OK4 D;  3SLE C;  2OK6 D;  4FA4 C;  2AH0 D;  2Q7Q D;  2IUV D;  3SWS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...