4FA5C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 20 days
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa5C00
1MG3B 2J56L 2AGLD 2MTAL 2MADL 2AGWD 4FANC 1MAFL 2AGXD 3SJLC 2I0SD 3ORVC 4O1QC 2AH1D 2AGZD 4L3GC 2BBKL 4Y5RC 2H47B 2HJBD 4FA1C 2AGYD 3SWSC 2IUPD 2HKRD 4FA4C 4FAVC 3L4OC 2IURD 3RN1C 2OIZD 4FB1C 3PXWC 2HKMD 3PXSC 3SXTC 1MAEL 3L4MC 2AH0D 3RMZC 4L3HC 1MG2B 2I0TD 3SVWC 2Q7QD 2OJYD 2OK6D 4FA5C 2IUVD 2HJ4D 2J57K 3C75L 4FA9C 2IUQD 4L1QC 3RLMC 4K3IC 2GC4B 2I0RD 2IAAB 1MDAL 3RN0C 2HXCD 2GC7B 2OK4D 3PXTC 3SLEC 2H3XB 2J55L
chains in the Genus database with same CATH superfamily
1MG3B 2J56L 2AGLD 2MTAL 2MADL 2AGWD 4FANC 1MAFL 2AGXD 3SJLC 2I0SD 3ORVC 4O1QC 2AH1D 2AGZD 4L3GC 2BBKL 4Y5RC 2H47B 2HJBD 4FA1C 2AGYD 3SWSC 2IUPD 2HKRD 4FA4C 4FAVC 3L4OC 2IURD 3RN1C 2OIZD 4FB1C 3PXWC 2HKMD 3PXSC 3SXTC 1MAEL 3L4MC 2AH0D 3RMZC 4L3HC 1MG2B 2I0TD 3SVWC 2Q7QD 2OJYD 2OK6D 4FA5C 2IUVD 2HJ4D 2J57K 3C75L 4FA9C 2IUQD 4L1QC 3RLMC 4K3IC 2GC4B 2I0RD 2IAAB 1MDAL 3RN0C 2HXCD 2GC7B 2OK4D 3PXTC 3SLEC 2H3XB 2J55L
chains in the Genus database with same CATH topology
1MG3B 2J56L 2AGLD 2MTAL 2MADL 2AGWD 4FANC 1MAFL 2AGXD 3SJLC 2I0SD 3ORVC 4O1QC 2AH1D 2AGZD 4L3GC 2BBKL 4Y5RC 2H47B 2HJBD 4FA1C 2AGYD 3SWSC 2IUPD 2HKRD 4FA4C 4FAVC 3L4OC 2IURD 3RN1C 2OIZD 4FB1C 3PXWC 2HKMD 3PXSC 3SXTC 1MAEL 3L4MC 2AH0D 3RMZC 4L3HC 1MG2B 2I0TD 3SVWC 2Q7QD 2OJYD 2OK6D 4FA5C 2IUVD 2HJ4D 2J57K 3C75L 4FA9C 2IUQD 4L1QC 3RLMC 4K3IC 2GC4B 2I0RD 2IAAB 1MDAL 3RN0C 2HXCD 2GC7B 2OK4D 3PXTC 3SLEC 2H3XB 2J55L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG3 B;  2J56 L;  2AGL D;  2MTA L;  2MAD L;  2AGW D;  4FAN C;  1MAF L;  2AGX D;  3SJL C;  2I0S D;  3ORV C;  4O1Q C;  2AH1 D;  2AGZ D;  4L3G C;  2BBK L;  4Y5R C;  2H47 B;  2HJB D;  4FA1 C;  2AGY D;  3SWS C;  2IUP D;  2HKR D;  4FA4 C;  4FAV C;  3L4O C;  2IUR D;  3RN1 C;  2OIZ D;  4FB1 C;  3PXW C;  2HKM D;  3PXS C;  3SXT C;  1MAE L;  3L4M C;  2AH0 D;  3RMZ C;  4L3H C;  1MG2 B;  2I0T D;  3SVW C;  2Q7Q D;  2OJY D;  2OK6 D;  4FA5 C;  2IUV D;  2HJ4 D;  2J57 K;  3C75 L;  4FA9 C;  2IUQ D;  4L1Q C;  3RLM C;  4K3I C;  2GC4 B;  2I0R D;  2IAA B;  1MDA L;  3RN0 C;  2HXC D;  2GC7 B;  2OK4 D;  3PXT C;  3SLE C;  2H3X B;  2J55 L; 
#chains in the Genus database with same CATH topology
 1MG3 B;  2J56 L;  2AGL D;  2MTA L;  2MAD L;  2AGW D;  4FAN C;  1MAF L;  2AGX D;  3SJL C;  2I0S D;  3ORV C;  4O1Q C;  2AH1 D;  2AGZ D;  4L3G C;  2BBK L;  4Y5R C;  2H47 B;  2HJB D;  4FA1 C;  2AGY D;  3SWS C;  2IUP D;  2HKR D;  4FA4 C;  4FAV C;  3L4O C;  2IUR D;  3RN1 C;  2OIZ D;  4FB1 C;  3PXW C;  2HKM D;  3PXS C;  3SXT C;  1MAE L;  3L4M C;  2AH0 D;  3RMZ C;  4L3H C;  1MG2 B;  2I0T D;  3SVW C;  2Q7Q D;  2OJY D;  2OK6 D;  4FA5 C;  2IUV D;  2HJ4 D;  2J57 K;  3C75 L;  4FA9 C;  2IUQ D;  4L1Q C;  3RLM C;  4K3I C;  2GC4 B;  2I0R D;  2IAA B;  1MDA L;  3RN0 C;  2HXC D;  2GC7 B;  2OK4 D;  3PXT C;  3SLE C;  2H3X B;  2J55 L; 
#chains in the Genus database with same CATH homology
 1MG3 B;  2J56 L;  2AGL D;  2MTA L;  2MAD L;  2AGW D;  4FAN C;  1MAF L;  2AGX D;  3SJL C;  2I0S D;  3ORV C;  4O1Q C;  2AH1 D;  2AGZ D;  4L3G C;  2BBK L;  4Y5R C;  2H47 B;  2HJB D;  4FA1 C;  2AGY D;  3SWS C;  2IUP D;  2HKR D;  4FA4 C;  4FAV C;  3L4O C;  2IUR D;  3RN1 C;  2OIZ D;  4FB1 C;  3PXW C;  2HKM D;  3PXS C;  3SXT C;  1MAE L;  3L4M C;  2AH0 D;  3RMZ C;  4L3H C;  1MG2 B;  2I0T D;  3SVW C;  2Q7Q D;  2OJY D;  2OK6 D;  4FA5 C;  2IUV D;  2HJ4 D;  2J57 K;  3C75 L;  4FA9 C;  2IUQ D;  4L1Q C;  3RLM C;  4K3I C;  2GC4 B;  2I0R D;  2IAA B;  1MDA L;  3RN0 C;  2HXC D;  2GC7 B;  2OK4 D;  3PXT C;  3SLE C;  2H3X B;  2J55 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...