2AGWD

Crystal structure of tryptamine-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agwD00
2BBKL 3ORVC 2I0RD 2HXCD 3SVWC 2AGXD 3RLMC 2HKMD 2HJBD 3C75L 4FANC 4FA5C 2J55L 2IUVD 1MDAL 4K3IC 2MADL 4FA4C 3PXSC 1MG2B 3SXTC 2GC4B 2HKRD 1MG3B 4FA1C 2H3XB 4L3HC 2AH0D 2AGZD 4FA9C 1MAFL 3L4MC 3PXWC 3SJLC 3SWSC 2I0SD 3RMZC 2Q7QD 2GC7B 3L4OC 2OK6D 2OIZD 3RN0C 2I0TD 2IUQD 4FAVC 3RN1C 2J56L 2HJ4D 3SLEC 2MTAL 2IAAB 4L3GC 2AH1D 2IUPD 4L1QC 1MAEL 2OJYD 4Y5RC 2H47B 3PXTC 2IURD 4FB1C 2AGWD 2OK4D 2AGYD 2AGLD 4O1QC 2J57K
chains in the Genus database with same CATH superfamily
2BBKL 3ORVC 2I0RD 2HXCD 3SVWC 2AGXD 3RLMC 2HKMD 2HJBD 3C75L 4FANC 4FA5C 2J55L 2IUVD 1MDAL 4K3IC 2MADL 4FA4C 3PXSC 1MG2B 3SXTC 2GC4B 2HKRD 1MG3B 4FA1C 2H3XB 4L3HC 2AH0D 2AGZD 4FA9C 1MAFL 3L4MC 3PXWC 3SJLC 3SWSC 2I0SD 3RMZC 2Q7QD 2GC7B 3L4OC 2OK6D 2OIZD 3RN0C 2I0TD 2IUQD 4FAVC 3RN1C 2J56L 2HJ4D 3SLEC 2MTAL 2IAAB 4L3GC 2AH1D 2IUPD 4L1QC 1MAEL 2OJYD 4Y5RC 2H47B 3PXTC 2IURD 4FB1C 2AGWD 2OK4D 2AGYD 2AGLD 4O1QC 2J57K
chains in the Genus database with same CATH topology
2BBKL 3ORVC 2I0RD 2HXCD 3SVWC 2AGXD 3RLMC 2HKMD 2HJBD 3C75L 4FANC 4FA5C 2J55L 2IUVD 1MDAL 4K3IC 2MADL 4FA4C 3PXSC 1MG2B 3SXTC 2GC4B 2HKRD 1MG3B 4FA1C 2H3XB 4L3HC 2AH0D 2AGZD 4FA9C 1MAFL 3L4MC 3PXWC 3SJLC 3SWSC 2I0SD 3RMZC 2Q7QD 2GC7B 3L4OC 2OK6D 2OIZD 3RN0C 2I0TD 2IUQD 4FAVC 3RN1C 2J56L 2HJ4D 3SLEC 2MTAL 2IAAB 4L3GC 2AH1D 2IUPD 4L1QC 1MAEL 2OJYD 4Y5RC 2H47B 3PXTC 2IURD 4FB1C 2AGWD 2OK4D 2AGYD 2AGLD 4O1QC 2J57K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBK L;  3ORV C;  2I0R D;  2HXC D;  3SVW C;  2AGX D;  3RLM C;  2HKM D;  2HJB D;  3C75 L;  4FAN C;  4FA5 C;  2J55 L;  2IUV D;  1MDA L;  4K3I C;  2MAD L;  4FA4 C;  3PXS C;  1MG2 B;  3SXT C;  2GC4 B;  2HKR D;  1MG3 B;  4FA1 C;  2H3X B;  4L3H C;  2AH0 D;  2AGZ D;  4FA9 C;  1MAF L;  3L4M C;  3PXW C;  3SJL C;  3SWS C;  2I0S D;  3RMZ C;  2Q7Q D;  2GC7 B;  3L4O C;  2OK6 D;  2OIZ D;  3RN0 C;  2I0T D;  2IUQ D;  4FAV C;  3RN1 C;  2J56 L;  2HJ4 D;  3SLE C;  2MTA L;  2IAA B;  4L3G C;  2AH1 D;  2IUP D;  4L1Q C;  1MAE L;  2OJY D;  4Y5R C;  2H47 B;  3PXT C;  2IUR D;  4FB1 C;  2AGW D;  2OK4 D;  2AGY D;  2AGL D;  4O1Q C;  2J57 K; 
#chains in the Genus database with same CATH topology
 2BBK L;  3ORV C;  2I0R D;  2HXC D;  3SVW C;  2AGX D;  3RLM C;  2HKM D;  2HJB D;  3C75 L;  4FAN C;  4FA5 C;  2J55 L;  2IUV D;  1MDA L;  4K3I C;  2MAD L;  4FA4 C;  3PXS C;  1MG2 B;  3SXT C;  2GC4 B;  2HKR D;  1MG3 B;  4FA1 C;  2H3X B;  4L3H C;  2AH0 D;  2AGZ D;  4FA9 C;  1MAF L;  3L4M C;  3PXW C;  3SJL C;  3SWS C;  2I0S D;  3RMZ C;  2Q7Q D;  2GC7 B;  3L4O C;  2OK6 D;  2OIZ D;  3RN0 C;  2I0T D;  2IUQ D;  4FAV C;  3RN1 C;  2J56 L;  2HJ4 D;  3SLE C;  2MTA L;  2IAA B;  4L3G C;  2AH1 D;  2IUP D;  4L1Q C;  1MAE L;  2OJY D;  4Y5R C;  2H47 B;  3PXT C;  2IUR D;  4FB1 C;  2AGW D;  2OK4 D;  2AGY D;  2AGL D;  4O1Q C;  2J57 K; 
#chains in the Genus database with same CATH homology
 2BBK L;  3ORV C;  2I0R D;  2HXC D;  3SVW C;  2AGX D;  3RLM C;  2HKM D;  2HJB D;  3C75 L;  4FAN C;  4FA5 C;  2J55 L;  2IUV D;  1MDA L;  4K3I C;  2MAD L;  4FA4 C;  3PXS C;  1MG2 B;  3SXT C;  2GC4 B;  2HKR D;  1MG3 B;  4FA1 C;  2H3X B;  4L3H C;  2AH0 D;  2AGZ D;  4FA9 C;  1MAF L;  3L4M C;  3PXW C;  3SJL C;  3SWS C;  2I0S D;  3RMZ C;  2Q7Q D;  2GC7 B;  3L4O C;  2OK6 D;  2OIZ D;  3RN0 C;  2I0T D;  2IUQ D;  4FAV C;  3RN1 C;  2J56 L;  2HJ4 D;  3SLE C;  2MTA L;  2IAA B;  4L3G C;  2AH1 D;  2IUP D;  4L1Q C;  1MAE L;  2OJY D;  4Y5R C;  2H47 B;  3PXT C;  2IUR D;  4FB1 C;  2AGW D;  2OK4 D;  2AGY D;  2AGL D;  4O1Q C;  2J57 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...