3SLEC

Crystal structure of the p107c-maug/pre-methylamine dehydrogenase complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
128
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sleC00
4K3IC 2HXCD 2BBKL 2IUQD 2OK4D 3RN1C 2I0RD 3C75L 2AGWD 2HKRD 2HKMD 3L4MC 2AGXD 3PXTC 3SLEC 3RN0C 4FB1C 2J55L 2Q7QD 2H3XB 3RMZC 4FA9C 1MDAL 3L4OC 4FA5C 4FAVC 4FA4C 4FANC 2IUVD 2AGZD 2IAAB 3SVWC 1MG3B 3ORVC 2I0TD 4L3GC 1MG2B 3RLMC 2J57K 3PXWC 2OK6D 2H47B 4L1QC 4Y5RC 1MAEL 4O1QC 4L3HC 2AGYD 2HJBD 2J56L 3SXTC 2OIZD 2I0SD 2OJYD 4FA1C 2MTAL 1MAFL 2AH0D 2MADL 3SWSC 2IURD 3SJLC 3PXSC 2GC7B 2GC4B 2HJ4D 2AGLD 2AH1D 2IUPD
chains in the Genus database with same CATH superfamily
4K3IC 2HXCD 2BBKL 2IUQD 2OK4D 3RN1C 2I0RD 3C75L 2AGWD 2HKRD 2HKMD 3L4MC 2AGXD 3PXTC 3SLEC 3RN0C 4FB1C 2J55L 2Q7QD 2H3XB 3RMZC 4FA9C 1MDAL 3L4OC 4FA5C 4FAVC 4FA4C 4FANC 2IUVD 2AGZD 2IAAB 3SVWC 1MG3B 3ORVC 2I0TD 4L3GC 1MG2B 3RLMC 2J57K 3PXWC 2OK6D 2H47B 4L1QC 4Y5RC 1MAEL 4O1QC 4L3HC 2AGYD 2HJBD 2J56L 3SXTC 2OIZD 2I0SD 2OJYD 4FA1C 2MTAL 1MAFL 2AH0D 2MADL 3SWSC 2IURD 3SJLC 3PXSC 2GC7B 2GC4B 2HJ4D 2AGLD 2AH1D 2IUPD
chains in the Genus database with same CATH topology
4K3IC 2HXCD 2BBKL 2IUQD 2OK4D 3RN1C 2I0RD 3C75L 2AGWD 2HKRD 2HKMD 3L4MC 2AGXD 3PXTC 3SLEC 3RN0C 4FB1C 2J55L 2Q7QD 2H3XB 3RMZC 4FA9C 1MDAL 3L4OC 4FA5C 4FAVC 4FA4C 4FANC 2IUVD 2AGZD 2IAAB 3SVWC 1MG3B 3ORVC 2I0TD 4L3GC 1MG2B 3RLMC 2J57K 3PXWC 2OK6D 2H47B 4L1QC 4Y5RC 1MAEL 4O1QC 4L3HC 2AGYD 2HJBD 2J56L 3SXTC 2OIZD 2I0SD 2OJYD 4FA1C 2MTAL 1MAFL 2AH0D 2MADL 3SWSC 2IURD 3SJLC 3PXSC 2GC7B 2GC4B 2HJ4D 2AGLD 2AH1D 2IUPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3I C;  2HXC D;  2BBK L;  2IUQ D;  2OK4 D;  3RN1 C;  2I0R D;  3C75 L;  2AGW D;  2HKR D;  2HKM D;  3L4M C;  2AGX D;  3PXT C;  3SLE C;  3RN0 C;  4FB1 C;  2J55 L;  2Q7Q D;  2H3X B;  3RMZ C;  4FA9 C;  1MDA L;  3L4O C;  4FA5 C;  4FAV C;  4FA4 C;  4FAN C;  2IUV D;  2AGZ D;  2IAA B;  3SVW C;  1MG3 B;  3ORV C;  2I0T D;  4L3G C;  1MG2 B;  3RLM C;  2J57 K;  3PXW C;  2OK6 D;  2H47 B;  4L1Q C;  4Y5R C;  1MAE L;  4O1Q C;  4L3H C;  2AGY D;  2HJB D;  2J56 L;  3SXT C;  2OIZ D;  2I0S D;  2OJY D;  4FA1 C;  2MTA L;  1MAF L;  2AH0 D;  2MAD L;  3SWS C;  2IUR D;  3SJL C;  3PXS C;  2GC7 B;  2GC4 B;  2HJ4 D;  2AGL D;  2AH1 D;  2IUP D; 
#chains in the Genus database with same CATH topology
 4K3I C;  2HXC D;  2BBK L;  2IUQ D;  2OK4 D;  3RN1 C;  2I0R D;  3C75 L;  2AGW D;  2HKR D;  2HKM D;  3L4M C;  2AGX D;  3PXT C;  3SLE C;  3RN0 C;  4FB1 C;  2J55 L;  2Q7Q D;  2H3X B;  3RMZ C;  4FA9 C;  1MDA L;  3L4O C;  4FA5 C;  4FAV C;  4FA4 C;  4FAN C;  2IUV D;  2AGZ D;  2IAA B;  3SVW C;  1MG3 B;  3ORV C;  2I0T D;  4L3G C;  1MG2 B;  3RLM C;  2J57 K;  3PXW C;  2OK6 D;  2H47 B;  4L1Q C;  4Y5R C;  1MAE L;  4O1Q C;  4L3H C;  2AGY D;  2HJB D;  2J56 L;  3SXT C;  2OIZ D;  2I0S D;  2OJY D;  4FA1 C;  2MTA L;  1MAF L;  2AH0 D;  2MAD L;  3SWS C;  2IUR D;  3SJL C;  3PXS C;  2GC7 B;  2GC4 B;  2HJ4 D;  2AGL D;  2AH1 D;  2IUP D; 
#chains in the Genus database with same CATH homology
 4K3I C;  2HXC D;  2BBK L;  2IUQ D;  2OK4 D;  3RN1 C;  2I0R D;  3C75 L;  2AGW D;  2HKR D;  2HKM D;  3L4M C;  2AGX D;  3PXT C;  3SLE C;  3RN0 C;  4FB1 C;  2J55 L;  2Q7Q D;  2H3X B;  3RMZ C;  4FA9 C;  1MDA L;  3L4O C;  4FA5 C;  4FAV C;  4FA4 C;  4FAN C;  2IUV D;  2AGZ D;  2IAA B;  3SVW C;  1MG3 B;  3ORV C;  2I0T D;  4L3G C;  1MG2 B;  3RLM C;  2J57 K;  3PXW C;  2OK6 D;  2H47 B;  4L1Q C;  4Y5R C;  1MAE L;  4O1Q C;  4L3H C;  2AGY D;  2HJB D;  2J56 L;  3SXT C;  2OIZ D;  2I0S D;  2OJY D;  4FA1 C;  2MTA L;  1MAF L;  2AH0 D;  2MAD L;  3SWS C;  2IUR D;  3SJL C;  3PXS C;  2GC7 B;  2GC4 B;  2HJ4 D;  2AGL D;  2AH1 D;  2IUP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...