3SLEC

Crystal structure of the p107c-maug/pre-methylamine dehydrogenase complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sleC00
2AGWD 2AGXD 2HJ4D 2MTAL 2I0RD 4K3IC 3RMZC 3SVWC 2J57K 3L4OC 3PXWC 3ORVC 4FA5C 3SXTC 2GC7B 3PXTC 2IUVD 2IURD 4FANC 4L3HC 2AGLD 2I0SD 3L4MC 3RLMC 3RN0C 3RN1C 4L1QC 3SWSC 2H3XB 2AH0D 3SJLC 3C75L 2IAAB 2BBKL 2AGYD 1MAEL 2IUPD 2H47B 2IUQD 1MG3B 2J56L 2GC4B 2I0TD 2J55L 2HKRD 2OK6D 2OIZD 4FAVC 2MADL 2HJBD 4O1QC 4L3GC 2AGZD 1MG2B 4Y5RC 4FA4C 2OK4D 1MAFL 2HXCD 4FA9C 4FA1C 2AH1D 2HKMD 3SLEC 1MDAL 4FB1C 3PXSC 2OJYD 2Q7QD
chains in the Genus database with same CATH superfamily
2AGWD 2AGXD 2HJ4D 2MTAL 2I0RD 4K3IC 3RMZC 3SVWC 2J57K 3L4OC 3PXWC 3ORVC 4FA5C 3SXTC 2GC7B 3PXTC 2IUVD 2IURD 4FANC 4L3HC 2AGLD 2I0SD 3L4MC 3RLMC 3RN0C 3RN1C 4L1QC 3SWSC 2H3XB 2AH0D 3SJLC 3C75L 2IAAB 2BBKL 2AGYD 1MAEL 2IUPD 2H47B 2IUQD 1MG3B 2J56L 2GC4B 2I0TD 2J55L 2HKRD 2OK6D 2OIZD 4FAVC 2MADL 2HJBD 4O1QC 4L3GC 2AGZD 1MG2B 4Y5RC 4FA4C 2OK4D 1MAFL 2HXCD 4FA9C 4FA1C 2AH1D 2HKMD 3SLEC 1MDAL 4FB1C 3PXSC 2OJYD 2Q7QD
chains in the Genus database with same CATH topology
2AGWD 2AGXD 2HJ4D 2MTAL 2I0RD 4K3IC 3RMZC 3SVWC 2J57K 3L4OC 3PXWC 3ORVC 4FA5C 3SXTC 2GC7B 3PXTC 2IUVD 2IURD 4FANC 4L3HC 2AGLD 2I0SD 3L4MC 3RLMC 3RN0C 3RN1C 4L1QC 3SWSC 2H3XB 2AH0D 3SJLC 3C75L 2IAAB 2BBKL 2AGYD 1MAEL 2IUPD 2H47B 2IUQD 1MG3B 2J56L 2GC4B 2I0TD 2J55L 2HKRD 2OK6D 2OIZD 4FAVC 2MADL 2HJBD 4O1QC 4L3GC 2AGZD 1MG2B 4Y5RC 4FA4C 2OK4D 1MAFL 2HXCD 4FA9C 4FA1C 2AH1D 2HKMD 3SLEC 1MDAL 4FB1C 3PXSC 2OJYD 2Q7QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW D;  2AGX D;  2HJ4 D;  2MTA L;  2I0R D;  4K3I C;  3RMZ C;  3SVW C;  2J57 K;  3L4O C;  3PXW C;  3ORV C;  4FA5 C;  3SXT C;  2GC7 B;  3PXT C;  2IUV D;  2IUR D;  4FAN C;  4L3H C;  2AGL D;  2I0S D;  3L4M C;  3RLM C;  3RN0 C;  3RN1 C;  4L1Q C;  3SWS C;  2H3X B;  2AH0 D;  3SJL C;  3C75 L;  2IAA B;  2BBK L;  2AGY D;  1MAE L;  2IUP D;  2H47 B;  2IUQ D;  1MG3 B;  2J56 L;  2GC4 B;  2I0T D;  2J55 L;  2HKR D;  2OK6 D;  2OIZ D;  4FAV C;  2MAD L;  2HJB D;  4O1Q C;  4L3G C;  2AGZ D;  1MG2 B;  4Y5R C;  4FA4 C;  2OK4 D;  1MAF L;  2HXC D;  4FA9 C;  4FA1 C;  2AH1 D;  2HKM D;  3SLE C;  1MDA L;  4FB1 C;  3PXS C;  2OJY D;  2Q7Q D; 
#chains in the Genus database with same CATH topology
 2AGW D;  2AGX D;  2HJ4 D;  2MTA L;  2I0R D;  4K3I C;  3RMZ C;  3SVW C;  2J57 K;  3L4O C;  3PXW C;  3ORV C;  4FA5 C;  3SXT C;  2GC7 B;  3PXT C;  2IUV D;  2IUR D;  4FAN C;  4L3H C;  2AGL D;  2I0S D;  3L4M C;  3RLM C;  3RN0 C;  3RN1 C;  4L1Q C;  3SWS C;  2H3X B;  2AH0 D;  3SJL C;  3C75 L;  2IAA B;  2BBK L;  2AGY D;  1MAE L;  2IUP D;  2H47 B;  2IUQ D;  1MG3 B;  2J56 L;  2GC4 B;  2I0T D;  2J55 L;  2HKR D;  2OK6 D;  2OIZ D;  4FAV C;  2MAD L;  2HJB D;  4O1Q C;  4L3G C;  2AGZ D;  1MG2 B;  4Y5R C;  4FA4 C;  2OK4 D;  1MAF L;  2HXC D;  4FA9 C;  4FA1 C;  2AH1 D;  2HKM D;  3SLE C;  1MDA L;  4FB1 C;  3PXS C;  2OJY D;  2Q7Q D; 
#chains in the Genus database with same CATH homology
 2AGW D;  2AGX D;  2HJ4 D;  2MTA L;  2I0R D;  4K3I C;  3RMZ C;  3SVW C;  2J57 K;  3L4O C;  3PXW C;  3ORV C;  4FA5 C;  3SXT C;  2GC7 B;  3PXT C;  2IUV D;  2IUR D;  4FAN C;  4L3H C;  2AGL D;  2I0S D;  3L4M C;  3RLM C;  3RN0 C;  3RN1 C;  4L1Q C;  3SWS C;  2H3X B;  2AH0 D;  3SJL C;  3C75 L;  2IAA B;  2BBK L;  2AGY D;  1MAE L;  2IUP D;  2H47 B;  2IUQ D;  1MG3 B;  2J56 L;  2GC4 B;  2I0T D;  2J55 L;  2HKR D;  2OK6 D;  2OIZ D;  4FAV C;  2MAD L;  2HJB D;  4O1Q C;  4L3G C;  2AGZ D;  1MG2 B;  4Y5R C;  4FA4 C;  2OK4 D;  1MAF L;  2HXC D;  4FA9 C;  4FA1 C;  2AH1 D;  2HKM D;  3SLE C;  1MDA L;  4FB1 C;  3PXS C;  2OJY D;  2Q7Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...