3SLEC

Crystal structure of the p107c-maug/pre-methylamine dehydrogenase complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 31
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3sleC00
1MDAL 4FB1C 2AGXD 2BBKL 3PXWC 2AH0D 2AGWD 4Y5RC 3L4OC 3SXTC 4FA1C 2IUVD 4FA9C 2H47B 2J57K 4K3IC 3SWSC 2IUPD 2J55L 3L4MC 2OK4D 4FA5C 3SVWC 4FA4C 4L3GC 1MG3B 4O1QC 2I0TD 2IAAB 2HXCD 2IURD 3C75L 1MAEL 2I0SD 2GC7B 2MTAL 4FANC 2HJ4D 4L1QC 4L3HC 2MADL 2H3XB 3ORVC 1MAFL 2HKMD 3PXTC 2OIZD 3RLMC 2AH1D 3RN0C 3RMZC 2HJBD 2IUQD 2AGYD 2OJYD 3SLEC 2I0RD 2HKRD 2AGZD 2Q7QD 1MG2B 4FAVC 2GC4B 3PXSC 2AGLD 3RN1C 3SJLC 2OK6D 2J56L
chains in the Genus database with same CATH superfamily
1MDAL 4FB1C 2AGXD 2BBKL 3PXWC 2AH0D 2AGWD 4Y5RC 3L4OC 3SXTC 4FA1C 2IUVD 4FA9C 2H47B 2J57K 4K3IC 3SWSC 2IUPD 2J55L 3L4MC 2OK4D 4FA5C 3SVWC 4FA4C 4L3GC 1MG3B 4O1QC 2I0TD 2IAAB 2HXCD 2IURD 3C75L 1MAEL 2I0SD 2GC7B 2MTAL 4FANC 2HJ4D 4L1QC 4L3HC 2MADL 2H3XB 3ORVC 1MAFL 2HKMD 3PXTC 2OIZD 3RLMC 2AH1D 3RN0C 3RMZC 2HJBD 2IUQD 2AGYD 2OJYD 3SLEC 2I0RD 2HKRD 2AGZD 2Q7QD 1MG2B 4FAVC 2GC4B 3PXSC 2AGLD 3RN1C 3SJLC 2OK6D 2J56L
chains in the Genus database with same CATH topology
1MDAL 4FB1C 2AGXD 2BBKL 3PXWC 2AH0D 2AGWD 4Y5RC 3L4OC 3SXTC 4FA1C 2IUVD 4FA9C 2H47B 2J57K 4K3IC 3SWSC 2IUPD 2J55L 3L4MC 2OK4D 4FA5C 3SVWC 4FA4C 4L3GC 1MG3B 4O1QC 2I0TD 2IAAB 2HXCD 2IURD 3C75L 1MAEL 2I0SD 2GC7B 2MTAL 4FANC 2HJ4D 4L1QC 4L3HC 2MADL 2H3XB 3ORVC 1MAFL 2HKMD 3PXTC 2OIZD 3RLMC 2AH1D 3RN0C 3RMZC 2HJBD 2IUQD 2AGYD 2OJYD 3SLEC 2I0RD 2HKRD 2AGZD 2Q7QD 1MG2B 4FAVC 2GC4B 3PXSC 2AGLD 3RN1C 3SJLC 2OK6D 2J56L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDA L;  4FB1 C;  2AGX D;  2BBK L;  3PXW C;  2AH0 D;  2AGW D;  4Y5R C;  3L4O C;  3SXT C;  4FA1 C;  2IUV D;  4FA9 C;  2H47 B;  2J57 K;  4K3I C;  3SWS C;  2IUP D;  2J55 L;  3L4M C;  2OK4 D;  4FA5 C;  3SVW C;  4FA4 C;  4L3G C;  1MG3 B;  4O1Q C;  2I0T D;  2IAA B;  2HXC D;  2IUR D;  3C75 L;  1MAE L;  2I0S D;  2GC7 B;  2MTA L;  4FAN C;  2HJ4 D;  4L1Q C;  4L3H C;  2MAD L;  2H3X B;  3ORV C;  1MAF L;  2HKM D;  3PXT C;  2OIZ D;  3RLM C;  2AH1 D;  3RN0 C;  3RMZ C;  2HJB D;  2IUQ D;  2AGY D;  2OJY D;  3SLE C;  2I0R D;  2HKR D;  2AGZ D;  2Q7Q D;  1MG2 B;  4FAV C;  2GC4 B;  3PXS C;  2AGL D;  3RN1 C;  3SJL C;  2OK6 D;  2J56 L; 
#chains in the Genus database with same CATH topology
 1MDA L;  4FB1 C;  2AGX D;  2BBK L;  3PXW C;  2AH0 D;  2AGW D;  4Y5R C;  3L4O C;  3SXT C;  4FA1 C;  2IUV D;  4FA9 C;  2H47 B;  2J57 K;  4K3I C;  3SWS C;  2IUP D;  2J55 L;  3L4M C;  2OK4 D;  4FA5 C;  3SVW C;  4FA4 C;  4L3G C;  1MG3 B;  4O1Q C;  2I0T D;  2IAA B;  2HXC D;  2IUR D;  3C75 L;  1MAE L;  2I0S D;  2GC7 B;  2MTA L;  4FAN C;  2HJ4 D;  4L1Q C;  4L3H C;  2MAD L;  2H3X B;  3ORV C;  1MAF L;  2HKM D;  3PXT C;  2OIZ D;  3RLM C;  2AH1 D;  3RN0 C;  3RMZ C;  2HJB D;  2IUQ D;  2AGY D;  2OJY D;  3SLE C;  2I0R D;  2HKR D;  2AGZ D;  2Q7Q D;  1MG2 B;  4FAV C;  2GC4 B;  3PXS C;  2AGL D;  3RN1 C;  3SJL C;  2OK6 D;  2J56 L; 
#chains in the Genus database with same CATH homology
 1MDA L;  4FB1 C;  2AGX D;  2BBK L;  3PXW C;  2AH0 D;  2AGW D;  4Y5R C;  3L4O C;  3SXT C;  4FA1 C;  2IUV D;  4FA9 C;  2H47 B;  2J57 K;  4K3I C;  3SWS C;  2IUP D;  2J55 L;  3L4M C;  2OK4 D;  4FA5 C;  3SVW C;  4FA4 C;  4L3G C;  1MG3 B;  4O1Q C;  2I0T D;  2IAA B;  2HXC D;  2IUR D;  3C75 L;  1MAE L;  2I0S D;  2GC7 B;  2MTA L;  4FAN C;  2HJ4 D;  4L1Q C;  4L3H C;  2MAD L;  2H3X B;  3ORV C;  1MAF L;  2HKM D;  3PXT C;  2OIZ D;  3RLM C;  2AH1 D;  3RN0 C;  3RMZ C;  2HJB D;  2IUQ D;  2AGY D;  2OJY D;  3SLE C;  2I0R D;  2HKR D;  2AGZ D;  2Q7Q D;  1MG2 B;  4FAV C;  2GC4 B;  3PXS C;  2AGL D;  3RN1 C;  3SJL C;  2OK6 D;  2J56 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...