2AH0D

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. monoclinic form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 26
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ah0D00
2J57K 4L3GC 2Q7QD 2IUQD 4FA5C 4FA9C 3C75L 3RLMC 2BBKL 2HJ4D 3L4MC 2J56L 4Y5RC 2AGWD 2GC4B 2AGXD 2MTAL 3RN1C 4FAVC 4L3HC 2I0TD 4FB1C 3SVWC 2AGYD 2GC7B 2IAAB 3PXSC 3ORVC 3L4OC 3PXWC 3SXTC 4FA4C 2OK6D 3PXTC 1MDAL 3SJLC 3RMZC 2H47B 1MAEL 2I0SD 4FANC 3RN0C 4FA1C 2HJBD 4L1QC 1MG3B 2IUPD 4K3IC 4O1QC 2J55L 2AH1D 2OK4D 3SLEC 1MG2B 2HXCD 2OIZD 2IUVD 3SWSC 2AGLD 1MAFL 2AGZD 2H3XB 2HKRD 2HKMD 2IURD 2MADL 2I0RD 2OJYD 2AH0D
chains in the Genus database with same CATH superfamily
2J57K 4L3GC 2Q7QD 2IUQD 4FA5C 4FA9C 3C75L 3RLMC 2BBKL 2HJ4D 3L4MC 2J56L 4Y5RC 2AGWD 2GC4B 2AGXD 2MTAL 3RN1C 4FAVC 4L3HC 2I0TD 4FB1C 3SVWC 2AGYD 2GC7B 2IAAB 3PXSC 3ORVC 3L4OC 3PXWC 3SXTC 4FA4C 2OK6D 3PXTC 1MDAL 3SJLC 3RMZC 2H47B 1MAEL 2I0SD 4FANC 3RN0C 4FA1C 2HJBD 4L1QC 1MG3B 2IUPD 4K3IC 4O1QC 2J55L 2AH1D 2OK4D 3SLEC 1MG2B 2HXCD 2OIZD 2IUVD 3SWSC 2AGLD 1MAFL 2AGZD 2H3XB 2HKRD 2HKMD 2IURD 2MADL 2I0RD 2OJYD 2AH0D
chains in the Genus database with same CATH topology
2J57K 4L3GC 2Q7QD 2IUQD 4FA5C 4FA9C 3C75L 3RLMC 2BBKL 2HJ4D 3L4MC 2J56L 4Y5RC 2AGWD 2GC4B 2AGXD 2MTAL 3RN1C 4FAVC 4L3HC 2I0TD 4FB1C 3SVWC 2AGYD 2GC7B 2IAAB 3PXSC 3ORVC 3L4OC 3PXWC 3SXTC 4FA4C 2OK6D 3PXTC 1MDAL 3SJLC 3RMZC 2H47B 1MAEL 2I0SD 4FANC 3RN0C 4FA1C 2HJBD 4L1QC 1MG3B 2IUPD 4K3IC 4O1QC 2J55L 2AH1D 2OK4D 3SLEC 1MG2B 2HXCD 2OIZD 2IUVD 3SWSC 2AGLD 1MAFL 2AGZD 2H3XB 2HKRD 2HKMD 2IURD 2MADL 2I0RD 2OJYD 2AH0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J57 K;  4L3G C;  2Q7Q D;  2IUQ D;  4FA5 C;  4FA9 C;  3C75 L;  3RLM C;  2BBK L;  2HJ4 D;  3L4M C;  2J56 L;  4Y5R C;  2AGW D;  2GC4 B;  2AGX D;  2MTA L;  3RN1 C;  4FAV C;  4L3H C;  2I0T D;  4FB1 C;  3SVW C;  2AGY D;  2GC7 B;  2IAA B;  3PXS C;  3ORV C;  3L4O C;  3PXW C;  3SXT C;  4FA4 C;  2OK6 D;  3PXT C;  1MDA L;  3SJL C;  3RMZ C;  2H47 B;  1MAE L;  2I0S D;  4FAN C;  3RN0 C;  4FA1 C;  2HJB D;  4L1Q C;  1MG3 B;  2IUP D;  4K3I C;  4O1Q C;  2J55 L;  2AH1 D;  2OK4 D;  3SLE C;  1MG2 B;  2HXC D;  2OIZ D;  2IUV D;  3SWS C;  2AGL D;  1MAF L;  2AGZ D;  2H3X B;  2HKR D;  2HKM D;  2IUR D;  2MAD L;  2I0R D;  2OJY D;  2AH0 D; 
#chains in the Genus database with same CATH topology
 2J57 K;  4L3G C;  2Q7Q D;  2IUQ D;  4FA5 C;  4FA9 C;  3C75 L;  3RLM C;  2BBK L;  2HJ4 D;  3L4M C;  2J56 L;  4Y5R C;  2AGW D;  2GC4 B;  2AGX D;  2MTA L;  3RN1 C;  4FAV C;  4L3H C;  2I0T D;  4FB1 C;  3SVW C;  2AGY D;  2GC7 B;  2IAA B;  3PXS C;  3ORV C;  3L4O C;  3PXW C;  3SXT C;  4FA4 C;  2OK6 D;  3PXT C;  1MDA L;  3SJL C;  3RMZ C;  2H47 B;  1MAE L;  2I0S D;  4FAN C;  3RN0 C;  4FA1 C;  2HJB D;  4L1Q C;  1MG3 B;  2IUP D;  4K3I C;  4O1Q C;  2J55 L;  2AH1 D;  2OK4 D;  3SLE C;  1MG2 B;  2HXC D;  2OIZ D;  2IUV D;  3SWS C;  2AGL D;  1MAF L;  2AGZ D;  2H3X B;  2HKR D;  2HKM D;  2IUR D;  2MAD L;  2I0R D;  2OJY D;  2AH0 D; 
#chains in the Genus database with same CATH homology
 2J57 K;  4L3G C;  2Q7Q D;  2IUQ D;  4FA5 C;  4FA9 C;  3C75 L;  3RLM C;  2BBK L;  2HJ4 D;  3L4M C;  2J56 L;  4Y5R C;  2AGW D;  2GC4 B;  2AGX D;  2MTA L;  3RN1 C;  4FAV C;  4L3H C;  2I0T D;  4FB1 C;  3SVW C;  2AGY D;  2GC7 B;  2IAA B;  3PXS C;  3ORV C;  3L4O C;  3PXW C;  3SXT C;  4FA4 C;  2OK6 D;  3PXT C;  1MDA L;  3SJL C;  3RMZ C;  2H47 B;  1MAE L;  2I0S D;  4FAN C;  3RN0 C;  4FA1 C;  2HJB D;  4L1Q C;  1MG3 B;  2IUP D;  4K3I C;  4O1Q C;  2J55 L;  2AH1 D;  2OK4 D;  3SLE C;  1MG2 B;  2HXC D;  2OIZ D;  2IUV D;  3SWS C;  2AGL D;  1MAF L;  2AGZ D;  2H3X B;  2HKR D;  2HKM D;  2IUR D;  2MAD L;  2I0R D;  2OJY D;  2AH0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...