2IAAB

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 2)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
113
structure length
112
Chain Sequence
EDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 26
structure length 112
sequence length 113
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iaaB00
3PXWC 4FANC 2OIZD 4L3HC 2I0TD 3C75L 2OK4D 3L4OC 1MAEL 2AH0D 4O1QC 2IURD 2IUPD 3PXTC 2AGYD 3RLMC 3RN1C 4L3GC 2HKRD 4FA4C 4FB1C 2HKMD 2OK6D 3SWSC 2BBKL 2J56L 1MG3B 2J55L 4K3IC 4FA9C 2AH1D 2OJYD 2AGLD 3SVWC 1MG2B 2J57K 4FAVC 2IAAB 3L4MC 2IUQD 2AGWD 2H3XB 1MAFL 2MTAL 4L1QC 1MDAL 4Y5RC 2MADL 3ORVC 3RMZC 2HJ4D 2HXCD 2GC7B 4FA1C 3SJLC 2IUVD 2I0RD 2Q7QD 2H47B 2AGZD 2GC4B 3RN0C 3SXTC 3SLEC 2AGXD 2HJBD 2I0SD 3PXSC 4FA5C
chains in the Genus database with same CATH superfamily
3PXWC 4FANC 2OIZD 4L3HC 2I0TD 3C75L 2OK4D 3L4OC 1MAEL 2AH0D 4O1QC 2IURD 2IUPD 3PXTC 2AGYD 3RLMC 3RN1C 4L3GC 2HKRD 4FA4C 4FB1C 2HKMD 2OK6D 3SWSC 2BBKL 2J56L 1MG3B 2J55L 4K3IC 4FA9C 2AH1D 2OJYD 2AGLD 3SVWC 1MG2B 2J57K 4FAVC 2IAAB 3L4MC 2IUQD 2AGWD 2H3XB 1MAFL 2MTAL 4L1QC 1MDAL 4Y5RC 2MADL 3ORVC 3RMZC 2HJ4D 2HXCD 2GC7B 4FA1C 3SJLC 2IUVD 2I0RD 2Q7QD 2H47B 2AGZD 2GC4B 3RN0C 3SXTC 3SLEC 2AGXD 2HJBD 2I0SD 3PXSC 4FA5C
chains in the Genus database with same CATH topology
3PXWC 4FANC 2OIZD 4L3HC 2I0TD 3C75L 2OK4D 3L4OC 1MAEL 2AH0D 4O1QC 2IURD 2IUPD 3PXTC 2AGYD 3RLMC 3RN1C 4L3GC 2HKRD 4FA4C 4FB1C 2HKMD 2OK6D 3SWSC 2BBKL 2J56L 1MG3B 2J55L 4K3IC 4FA9C 2AH1D 2OJYD 2AGLD 3SVWC 1MG2B 2J57K 4FAVC 2IAAB 3L4MC 2IUQD 2AGWD 2H3XB 1MAFL 2MTAL 4L1QC 1MDAL 4Y5RC 2MADL 3ORVC 3RMZC 2HJ4D 2HXCD 2GC7B 4FA1C 3SJLC 2IUVD 2I0RD 2Q7QD 2H47B 2AGZD 2GC4B 3RN0C 3SXTC 3SLEC 2AGXD 2HJBD 2I0SD 3PXSC 4FA5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXW C;  4FAN C;  2OIZ D;  4L3H C;  2I0T D;  3C75 L;  2OK4 D;  3L4O C;  1MAE L;  2AH0 D;  4O1Q C;  2IUR D;  2IUP D;  3PXT C;  2AGY D;  3RLM C;  3RN1 C;  4L3G C;  2HKR D;  4FA4 C;  4FB1 C;  2HKM D;  2OK6 D;  3SWS C;  2BBK L;  2J56 L;  1MG3 B;  2J55 L;  4K3I C;  4FA9 C;  2AH1 D;  2OJY D;  2AGL D;  3SVW C;  1MG2 B;  2J57 K;  4FAV C;  2IAA B;  3L4M C;  2IUQ D;  2AGW D;  2H3X B;  1MAF L;  2MTA L;  4L1Q C;  1MDA L;  4Y5R C;  2MAD L;  3ORV C;  3RMZ C;  2HJ4 D;  2HXC D;  2GC7 B;  4FA1 C;  3SJL C;  2IUV D;  2I0R D;  2Q7Q D;  2H47 B;  2AGZ D;  2GC4 B;  3RN0 C;  3SXT C;  3SLE C;  2AGX D;  2HJB D;  2I0S D;  3PXS C;  4FA5 C; 
#chains in the Genus database with same CATH topology
 3PXW C;  4FAN C;  2OIZ D;  4L3H C;  2I0T D;  3C75 L;  2OK4 D;  3L4O C;  1MAE L;  2AH0 D;  4O1Q C;  2IUR D;  2IUP D;  3PXT C;  2AGY D;  3RLM C;  3RN1 C;  4L3G C;  2HKR D;  4FA4 C;  4FB1 C;  2HKM D;  2OK6 D;  3SWS C;  2BBK L;  2J56 L;  1MG3 B;  2J55 L;  4K3I C;  4FA9 C;  2AH1 D;  2OJY D;  2AGL D;  3SVW C;  1MG2 B;  2J57 K;  4FAV C;  2IAA B;  3L4M C;  2IUQ D;  2AGW D;  2H3X B;  1MAF L;  2MTA L;  4L1Q C;  1MDA L;  4Y5R C;  2MAD L;  3ORV C;  3RMZ C;  2HJ4 D;  2HXC D;  2GC7 B;  4FA1 C;  3SJL C;  2IUV D;  2I0R D;  2Q7Q D;  2H47 B;  2AGZ D;  2GC4 B;  3RN0 C;  3SXT C;  3SLE C;  2AGX D;  2HJB D;  2I0S D;  3PXS C;  4FA5 C; 
#chains in the Genus database with same CATH homology
 3PXW C;  4FAN C;  2OIZ D;  4L3H C;  2I0T D;  3C75 L;  2OK4 D;  3L4O C;  1MAE L;  2AH0 D;  4O1Q C;  2IUR D;  2IUP D;  3PXT C;  2AGY D;  3RLM C;  3RN1 C;  4L3G C;  2HKR D;  4FA4 C;  4FB1 C;  2HKM D;  2OK6 D;  3SWS C;  2BBK L;  2J56 L;  1MG3 B;  2J55 L;  4K3I C;  4FA9 C;  2AH1 D;  2OJY D;  2AGL D;  3SVW C;  1MG2 B;  2J57 K;  4FAV C;  2IAA B;  3L4M C;  2IUQ D;  2AGW D;  2H3X B;  1MAF L;  2MTA L;  4L1Q C;  1MDA L;  4Y5R C;  2MAD L;  3ORV C;  3RMZ C;  2HJ4 D;  2HXC D;  2GC7 B;  4FA1 C;  3SJL C;  2IUV D;  2I0R D;  2Q7Q D;  2H47 B;  2AGZ D;  2GC4 B;  3RN0 C;  3SXT C;  3SLE C;  2AGX D;  2HJB D;  2I0S D;  3PXS C;  4FA5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...