2IAAB

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 2)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
113
structure length
112
Chain Sequence
EDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
total genus 26
structure length 112
sequence length 113
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iaaB00
3SWSC 1MG2B 3RN1C 2OIZD 4FA5C 2J55L 2OJYD 2Q7QD 2HKMD 3RLMC 2AGWD 2OK4D 3SXTC 4O1QC 3SJLC 2HKRD 3L4OC 3L4MC 3RN0C 4FA9C 2MTAL 2AH0D 2AGYD 2AGZD 3PXTC 3PXSC 4K3IC 2IUVD 2MADL 1MG3B 3PXWC 4FAVC 2J56L 1MDAL 2H47B 2I0SD 3SVWC 4L1QC 1MAEL 2I0TD 2HJBD 2IAAB 4FANC 2BBKL 3C75L 2AGXD 2J57K 3ORVC 3RMZC 4L3GC 4L3HC 2GC7B 2GC4B 2H3XB 2HXCD 3SLEC 4FA4C 2OK6D 2IUPD 2IUQD 2IURD 1MAFL 4FA1C 2AGLD 4Y5RC 2I0RD 2AH1D 2HJ4D 4FB1C
chains in the Genus database with same CATH superfamily
3SWSC 1MG2B 3RN1C 2OIZD 4FA5C 2J55L 2OJYD 2Q7QD 2HKMD 3RLMC 2AGWD 2OK4D 3SXTC 4O1QC 3SJLC 2HKRD 3L4OC 3L4MC 3RN0C 4FA9C 2MTAL 2AH0D 2AGYD 2AGZD 3PXTC 3PXSC 4K3IC 2IUVD 2MADL 1MG3B 3PXWC 4FAVC 2J56L 1MDAL 2H47B 2I0SD 3SVWC 4L1QC 1MAEL 2I0TD 2HJBD 2IAAB 4FANC 2BBKL 3C75L 2AGXD 2J57K 3ORVC 3RMZC 4L3GC 4L3HC 2GC7B 2GC4B 2H3XB 2HXCD 3SLEC 4FA4C 2OK6D 2IUPD 2IUQD 2IURD 1MAFL 4FA1C 2AGLD 4Y5RC 2I0RD 2AH1D 2HJ4D 4FB1C
chains in the Genus database with same CATH topology
3SWSC 1MG2B 3RN1C 2OIZD 4FA5C 2J55L 2OJYD 2Q7QD 2HKMD 3RLMC 2AGWD 2OK4D 3SXTC 4O1QC 3SJLC 2HKRD 3L4OC 3L4MC 3RN0C 4FA9C 2MTAL 2AH0D 2AGYD 2AGZD 3PXTC 3PXSC 4K3IC 2IUVD 2MADL 1MG3B 3PXWC 4FAVC 2J56L 1MDAL 2H47B 2I0SD 3SVWC 4L1QC 1MAEL 2I0TD 2HJBD 2IAAB 4FANC 2BBKL 3C75L 2AGXD 2J57K 3ORVC 3RMZC 4L3GC 4L3HC 2GC7B 2GC4B 2H3XB 2HXCD 3SLEC 4FA4C 2OK6D 2IUPD 2IUQD 2IURD 1MAFL 4FA1C 2AGLD 4Y5RC 2I0RD 2AH1D 2HJ4D 4FB1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWS C;  1MG2 B;  3RN1 C;  2OIZ D;  4FA5 C;  2J55 L;  2OJY D;  2Q7Q D;  2HKM D;  3RLM C;  2AGW D;  2OK4 D;  3SXT C;  4O1Q C;  3SJL C;  2HKR D;  3L4O C;  3L4M C;  3RN0 C;  4FA9 C;  2MTA L;  2AH0 D;  2AGY D;  2AGZ D;  3PXT C;  3PXS C;  4K3I C;  2IUV D;  2MAD L;  1MG3 B;  3PXW C;  4FAV C;  2J56 L;  1MDA L;  2H47 B;  2I0S D;  3SVW C;  4L1Q C;  1MAE L;  2I0T D;  2HJB D;  2IAA B;  4FAN C;  2BBK L;  3C75 L;  2AGX D;  2J57 K;  3ORV C;  3RMZ C;  4L3G C;  4L3H C;  2GC7 B;  2GC4 B;  2H3X B;  2HXC D;  3SLE C;  4FA4 C;  2OK6 D;  2IUP D;  2IUQ D;  2IUR D;  1MAF L;  4FA1 C;  2AGL D;  4Y5R C;  2I0R D;  2AH1 D;  2HJ4 D;  4FB1 C; 
#chains in the Genus database with same CATH topology
 3SWS C;  1MG2 B;  3RN1 C;  2OIZ D;  4FA5 C;  2J55 L;  2OJY D;  2Q7Q D;  2HKM D;  3RLM C;  2AGW D;  2OK4 D;  3SXT C;  4O1Q C;  3SJL C;  2HKR D;  3L4O C;  3L4M C;  3RN0 C;  4FA9 C;  2MTA L;  2AH0 D;  2AGY D;  2AGZ D;  3PXT C;  3PXS C;  4K3I C;  2IUV D;  2MAD L;  1MG3 B;  3PXW C;  4FAV C;  2J56 L;  1MDA L;  2H47 B;  2I0S D;  3SVW C;  4L1Q C;  1MAE L;  2I0T D;  2HJB D;  2IAA B;  4FAN C;  2BBK L;  3C75 L;  2AGX D;  2J57 K;  3ORV C;  3RMZ C;  4L3G C;  4L3H C;  2GC7 B;  2GC4 B;  2H3X B;  2HXC D;  3SLE C;  4FA4 C;  2OK6 D;  2IUP D;  2IUQ D;  2IUR D;  1MAF L;  4FA1 C;  2AGL D;  4Y5R C;  2I0R D;  2AH1 D;  2HJ4 D;  4FB1 C; 
#chains in the Genus database with same CATH homology
 3SWS C;  1MG2 B;  3RN1 C;  2OIZ D;  4FA5 C;  2J55 L;  2OJY D;  2Q7Q D;  2HKM D;  3RLM C;  2AGW D;  2OK4 D;  3SXT C;  4O1Q C;  3SJL C;  2HKR D;  3L4O C;  3L4M C;  3RN0 C;  4FA9 C;  2MTA L;  2AH0 D;  2AGY D;  2AGZ D;  3PXT C;  3PXS C;  4K3I C;  2IUV D;  2MAD L;  1MG3 B;  3PXW C;  4FAV C;  2J56 L;  1MDA L;  2H47 B;  2I0S D;  3SVW C;  4L1Q C;  1MAE L;  2I0T D;  2HJB D;  2IAA B;  4FAN C;  2BBK L;  3C75 L;  2AGX D;  2J57 K;  3ORV C;  3RMZ C;  4L3G C;  4L3H C;  2GC7 B;  2GC4 B;  2H3X B;  2HXC D;  3SLE C;  4FA4 C;  2OK6 D;  2IUP D;  2IUQ D;  2IUR D;  1MAF L;  4FA1 C;  2AGL D;  4Y5R C;  2I0R D;  2AH1 D;  2HJ4 D;  4FB1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...