3RN0C

Crystal structure of the w199k-maug/pre-methylamine dehydrogenase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3rn0C00
2I0RD 2HJBD 2IUVD 2AGXD 2J56L 2OK4D 2HKMD 2HKRD 2HXCD 4FANC 4FA4C 3SVWC 3RMZC 4FA5C 2I0SD 2GC7B 2MADL 4K3IC 2OK6D 2J57K 2AGLD 2AH1D 3SLEC 2H47B 2HJ4D 3C75L 4FB1C 1MG3B 3RLMC 2AH0D 4FA9C 4O1QC 4L1QC 1MG2B 2J55L 4L3HC 3RN1C 2AGYD 3L4MC 2IAAB 1MDAL 2AGZD 3PXSC 3PXTC 3ORVC 2BBKL 2OIZD 1MAEL 3SXTC 4FAVC 2AGWD 2OJYD 2IUPD 4FA1C 4L3GC 2H3XB 2I0TD 1MAFL 2GC4B 3SWSC 2IUQD 2IURD 4Y5RC 3PXWC 3RN0C 3L4OC 2MTAL 3SJLC 2Q7QD
chains in the Genus database with same CATH superfamily
2I0RD 2HJBD 2IUVD 2AGXD 2J56L 2OK4D 2HKMD 2HKRD 2HXCD 4FANC 4FA4C 3SVWC 3RMZC 4FA5C 2I0SD 2GC7B 2MADL 4K3IC 2OK6D 2J57K 2AGLD 2AH1D 3SLEC 2H47B 2HJ4D 3C75L 4FB1C 1MG3B 3RLMC 2AH0D 4FA9C 4O1QC 4L1QC 1MG2B 2J55L 4L3HC 3RN1C 2AGYD 3L4MC 2IAAB 1MDAL 2AGZD 3PXSC 3PXTC 3ORVC 2BBKL 2OIZD 1MAEL 3SXTC 4FAVC 2AGWD 2OJYD 2IUPD 4FA1C 4L3GC 2H3XB 2I0TD 1MAFL 2GC4B 3SWSC 2IUQD 2IURD 4Y5RC 3PXWC 3RN0C 3L4OC 2MTAL 3SJLC 2Q7QD
chains in the Genus database with same CATH topology
2I0RD 2HJBD 2IUVD 2AGXD 2J56L 2OK4D 2HKMD 2HKRD 2HXCD 4FANC 4FA4C 3SVWC 3RMZC 4FA5C 2I0SD 2GC7B 2MADL 4K3IC 2OK6D 2J57K 2AGLD 2AH1D 3SLEC 2H47B 2HJ4D 3C75L 4FB1C 1MG3B 3RLMC 2AH0D 4FA9C 4O1QC 4L1QC 1MG2B 2J55L 4L3HC 3RN1C 2AGYD 3L4MC 2IAAB 1MDAL 2AGZD 3PXSC 3PXTC 3ORVC 2BBKL 2OIZD 1MAEL 3SXTC 4FAVC 2AGWD 2OJYD 2IUPD 4FA1C 4L3GC 2H3XB 2I0TD 1MAFL 2GC4B 3SWSC 2IUQD 2IURD 4Y5RC 3PXWC 3RN0C 3L4OC 2MTAL 3SJLC 2Q7QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0R D;  2HJB D;  2IUV D;  2AGX D;  2J56 L;  2OK4 D;  2HKM D;  2HKR D;  2HXC D;  4FAN C;  4FA4 C;  3SVW C;  3RMZ C;  4FA5 C;  2I0S D;  2GC7 B;  2MAD L;  4K3I C;  2OK6 D;  2J57 K;  2AGL D;  2AH1 D;  3SLE C;  2H47 B;  2HJ4 D;  3C75 L;  4FB1 C;  1MG3 B;  3RLM C;  2AH0 D;  4FA9 C;  4O1Q C;  4L1Q C;  1MG2 B;  2J55 L;  4L3H C;  3RN1 C;  2AGY D;  3L4M C;  2IAA B;  1MDA L;  2AGZ D;  3PXS C;  3PXT C;  3ORV C;  2BBK L;  2OIZ D;  1MAE L;  3SXT C;  4FAV C;  2AGW D;  2OJY D;  2IUP D;  4FA1 C;  4L3G C;  2H3X B;  2I0T D;  1MAF L;  2GC4 B;  3SWS C;  2IUQ D;  2IUR D;  4Y5R C;  3PXW C;  3RN0 C;  3L4O C;  2MTA L;  3SJL C;  2Q7Q D; 
#chains in the Genus database with same CATH topology
 2I0R D;  2HJB D;  2IUV D;  2AGX D;  2J56 L;  2OK4 D;  2HKM D;  2HKR D;  2HXC D;  4FAN C;  4FA4 C;  3SVW C;  3RMZ C;  4FA5 C;  2I0S D;  2GC7 B;  2MAD L;  4K3I C;  2OK6 D;  2J57 K;  2AGL D;  2AH1 D;  3SLE C;  2H47 B;  2HJ4 D;  3C75 L;  4FB1 C;  1MG3 B;  3RLM C;  2AH0 D;  4FA9 C;  4O1Q C;  4L1Q C;  1MG2 B;  2J55 L;  4L3H C;  3RN1 C;  2AGY D;  3L4M C;  2IAA B;  1MDA L;  2AGZ D;  3PXS C;  3PXT C;  3ORV C;  2BBK L;  2OIZ D;  1MAE L;  3SXT C;  4FAV C;  2AGW D;  2OJY D;  2IUP D;  4FA1 C;  4L3G C;  2H3X B;  2I0T D;  1MAF L;  2GC4 B;  3SWS C;  2IUQ D;  2IUR D;  4Y5R C;  3PXW C;  3RN0 C;  3L4O C;  2MTA L;  3SJL C;  2Q7Q D; 
#chains in the Genus database with same CATH homology
 2I0R D;  2HJB D;  2IUV D;  2AGX D;  2J56 L;  2OK4 D;  2HKM D;  2HKR D;  2HXC D;  4FAN C;  4FA4 C;  3SVW C;  3RMZ C;  4FA5 C;  2I0S D;  2GC7 B;  2MAD L;  4K3I C;  2OK6 D;  2J57 K;  2AGL D;  2AH1 D;  3SLE C;  2H47 B;  2HJ4 D;  3C75 L;  4FB1 C;  1MG3 B;  3RLM C;  2AH0 D;  4FA9 C;  4O1Q C;  4L1Q C;  1MG2 B;  2J55 L;  4L3H C;  3RN1 C;  2AGY D;  3L4M C;  2IAA B;  1MDA L;  2AGZ D;  3PXS C;  3PXT C;  3ORV C;  2BBK L;  2OIZ D;  1MAE L;  3SXT C;  4FAV C;  2AGW D;  2OJY D;  2IUP D;  4FA1 C;  4L3G C;  2H3X B;  2I0T D;  1MAF L;  2GC4 B;  3SWS C;  2IUQ D;  2IUR D;  4Y5R C;  3PXW C;  3RN0 C;  3L4O C;  2MTA L;  3SJL C;  2Q7Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...