3RN0C

Crystal structure of the w199k-maug/pre-methylamine dehydrogenase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Mutagenesis of tryptophan199 suggests that hopping is required for MauG-dependent tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3rn0C00
2AGXD 4L3HC 2AH1D 2OIZD 2GC7B 4FA1C 4FANC 3L4OC 3SXTC 4FB1C 4FA9C 2J57K 2J55L 1MG2B 2Q7QD 2AGLD 2HJ4D 2MADL 4L3GC 1MAFL 2H3XB 1MG3B 2MTAL 2OJYD 3ORVC 2OK4D 2H47B 3PXTC 3RLMC 2AGZD 3SLEC 1MAEL 1MDAL 3PXWC 2AH0D 2HKMD 4FA4C 4FA5C 2IAAB 3SWSC 3L4MC 2IUQD 3C75L 2I0RD 3PXSC 4O1QC 3RN0C 4FAVC 3SVWC 4K3IC 3RMZC 3RN1C 2HXCD 2AGYD 2BBKL 2IUPD 2HKRD 2IURD 2OK6D 4L1QC 4Y5RC 2IUVD 2J56L 2HJBD 3SJLC 2I0TD 2AGWD 2GC4B 2I0SD
chains in the Genus database with same CATH superfamily
2AGXD 4L3HC 2AH1D 2OIZD 2GC7B 4FA1C 4FANC 3L4OC 3SXTC 4FB1C 4FA9C 2J57K 2J55L 1MG2B 2Q7QD 2AGLD 2HJ4D 2MADL 4L3GC 1MAFL 2H3XB 1MG3B 2MTAL 2OJYD 3ORVC 2OK4D 2H47B 3PXTC 3RLMC 2AGZD 3SLEC 1MAEL 1MDAL 3PXWC 2AH0D 2HKMD 4FA4C 4FA5C 2IAAB 3SWSC 3L4MC 2IUQD 3C75L 2I0RD 3PXSC 4O1QC 3RN0C 4FAVC 3SVWC 4K3IC 3RMZC 3RN1C 2HXCD 2AGYD 2BBKL 2IUPD 2HKRD 2IURD 2OK6D 4L1QC 4Y5RC 2IUVD 2J56L 2HJBD 3SJLC 2I0TD 2AGWD 2GC4B 2I0SD
chains in the Genus database with same CATH topology
2AGXD 4L3HC 2AH1D 2OIZD 2GC7B 4FA1C 4FANC 3L4OC 3SXTC 4FB1C 4FA9C 2J57K 2J55L 1MG2B 2Q7QD 2AGLD 2HJ4D 2MADL 4L3GC 1MAFL 2H3XB 1MG3B 2MTAL 2OJYD 3ORVC 2OK4D 2H47B 3PXTC 3RLMC 2AGZD 3SLEC 1MAEL 1MDAL 3PXWC 2AH0D 2HKMD 4FA4C 4FA5C 2IAAB 3SWSC 3L4MC 2IUQD 3C75L 2I0RD 3PXSC 4O1QC 3RN0C 4FAVC 3SVWC 4K3IC 3RMZC 3RN1C 2HXCD 2AGYD 2BBKL 2IUPD 2HKRD 2IURD 2OK6D 4L1QC 4Y5RC 2IUVD 2J56L 2HJBD 3SJLC 2I0TD 2AGWD 2GC4B 2I0SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGX D;  4L3H C;  2AH1 D;  2OIZ D;  2GC7 B;  4FA1 C;  4FAN C;  3L4O C;  3SXT C;  4FB1 C;  4FA9 C;  2J57 K;  2J55 L;  1MG2 B;  2Q7Q D;  2AGL D;  2HJ4 D;  2MAD L;  4L3G C;  1MAF L;  2H3X B;  1MG3 B;  2MTA L;  2OJY D;  3ORV C;  2OK4 D;  2H47 B;  3PXT C;  3RLM C;  2AGZ D;  3SLE C;  1MAE L;  1MDA L;  3PXW C;  2AH0 D;  2HKM D;  4FA4 C;  4FA5 C;  2IAA B;  3SWS C;  3L4M C;  2IUQ D;  3C75 L;  2I0R D;  3PXS C;  4O1Q C;  3RN0 C;  4FAV C;  3SVW C;  4K3I C;  3RMZ C;  3RN1 C;  2HXC D;  2AGY D;  2BBK L;  2IUP D;  2HKR D;  2IUR D;  2OK6 D;  4L1Q C;  4Y5R C;  2IUV D;  2J56 L;  2HJB D;  3SJL C;  2I0T D;  2AGW D;  2GC4 B;  2I0S D; 
#chains in the Genus database with same CATH topology
 2AGX D;  4L3H C;  2AH1 D;  2OIZ D;  2GC7 B;  4FA1 C;  4FAN C;  3L4O C;  3SXT C;  4FB1 C;  4FA9 C;  2J57 K;  2J55 L;  1MG2 B;  2Q7Q D;  2AGL D;  2HJ4 D;  2MAD L;  4L3G C;  1MAF L;  2H3X B;  1MG3 B;  2MTA L;  2OJY D;  3ORV C;  2OK4 D;  2H47 B;  3PXT C;  3RLM C;  2AGZ D;  3SLE C;  1MAE L;  1MDA L;  3PXW C;  2AH0 D;  2HKM D;  4FA4 C;  4FA5 C;  2IAA B;  3SWS C;  3L4M C;  2IUQ D;  3C75 L;  2I0R D;  3PXS C;  4O1Q C;  3RN0 C;  4FAV C;  3SVW C;  4K3I C;  3RMZ C;  3RN1 C;  2HXC D;  2AGY D;  2BBK L;  2IUP D;  2HKR D;  2IUR D;  2OK6 D;  4L1Q C;  4Y5R C;  2IUV D;  2J56 L;  2HJB D;  3SJL C;  2I0T D;  2AGW D;  2GC4 B;  2I0S D; 
#chains in the Genus database with same CATH homology
 2AGX D;  4L3H C;  2AH1 D;  2OIZ D;  2GC7 B;  4FA1 C;  4FAN C;  3L4O C;  3SXT C;  4FB1 C;  4FA9 C;  2J57 K;  2J55 L;  1MG2 B;  2Q7Q D;  2AGL D;  2HJ4 D;  2MAD L;  4L3G C;  1MAF L;  2H3X B;  1MG3 B;  2MTA L;  2OJY D;  3ORV C;  2OK4 D;  2H47 B;  3PXT C;  3RLM C;  2AGZ D;  3SLE C;  1MAE L;  1MDA L;  3PXW C;  2AH0 D;  2HKM D;  4FA4 C;  4FA5 C;  2IAA B;  3SWS C;  3L4M C;  2IUQ D;  3C75 L;  2I0R D;  3PXS C;  4O1Q C;  3RN0 C;  4FAV C;  3SVW C;  4K3I C;  3RMZ C;  3RN1 C;  2HXC D;  2AGY D;  2BBK L;  2IUP D;  2HKR D;  2IUR D;  2OK6 D;  4L1Q C;  4Y5R C;  2IUV D;  2J56 L;  2HJB D;  3SJL C;  2I0T D;  2AGW D;  2GC4 B;  2I0S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...