4FA1C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 130 days.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa1C00
2OK6D 2MADL 1MG2B 2H3XB 3SXTC 3RLMC 1MG3B 4FA9C 4FA1C 2GC4B 2HJBD 2IURD 3PXTC 2GC7B 2OIZD 2AGWD 4FB1C 4FAVC 2AH1D 2OK4D 2AGYD 3L4MC 2J56L 3C75L 2AGLD 4Y5RC 2I0SD 2IAAB 2J57K 3SLEC 3PXWC 2J55L 2I0RD 2MTAL 4L3HC 1MAFL 4O1QC 2IUPD 2Q7QD 2HKRD 3PXSC 1MAEL 2HXCD 4FA5C 2AGXD 2H47B 3RN0C 4FANC 3L4OC 4K3IC 3RN1C 4L1QC 4FA4C 2HKMD 2IUQD 2IUVD 3ORVC 2AH0D 2OJYD 4L3GC 2BBKL 3SJLC 2I0TD 3SVWC 2AGZD 1MDAL 2HJ4D 3SWSC 3RMZC
chains in the Genus database with same CATH superfamily
2OK6D 2MADL 1MG2B 2H3XB 3SXTC 3RLMC 1MG3B 4FA9C 4FA1C 2GC4B 2HJBD 2IURD 3PXTC 2GC7B 2OIZD 2AGWD 4FB1C 4FAVC 2AH1D 2OK4D 2AGYD 3L4MC 2J56L 3C75L 2AGLD 4Y5RC 2I0SD 2IAAB 2J57K 3SLEC 3PXWC 2J55L 2I0RD 2MTAL 4L3HC 1MAFL 4O1QC 2IUPD 2Q7QD 2HKRD 3PXSC 1MAEL 2HXCD 4FA5C 2AGXD 2H47B 3RN0C 4FANC 3L4OC 4K3IC 3RN1C 4L1QC 4FA4C 2HKMD 2IUQD 2IUVD 3ORVC 2AH0D 2OJYD 4L3GC 2BBKL 3SJLC 2I0TD 3SVWC 2AGZD 1MDAL 2HJ4D 3SWSC 3RMZC
chains in the Genus database with same CATH topology
2OK6D 2MADL 1MG2B 2H3XB 3SXTC 3RLMC 1MG3B 4FA9C 4FA1C 2GC4B 2HJBD 2IURD 3PXTC 2GC7B 2OIZD 2AGWD 4FB1C 4FAVC 2AH1D 2OK4D 2AGYD 3L4MC 2J56L 3C75L 2AGLD 4Y5RC 2I0SD 2IAAB 2J57K 3SLEC 3PXWC 2J55L 2I0RD 2MTAL 4L3HC 1MAFL 4O1QC 2IUPD 2Q7QD 2HKRD 3PXSC 1MAEL 2HXCD 4FA5C 2AGXD 2H47B 3RN0C 4FANC 3L4OC 4K3IC 3RN1C 4L1QC 4FA4C 2HKMD 2IUQD 2IUVD 3ORVC 2AH0D 2OJYD 4L3GC 2BBKL 3SJLC 2I0TD 3SVWC 2AGZD 1MDAL 2HJ4D 3SWSC 3RMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK6 D;  2MAD L;  1MG2 B;  2H3X B;  3SXT C;  3RLM C;  1MG3 B;  4FA9 C;  4FA1 C;  2GC4 B;  2HJB D;  2IUR D;  3PXT C;  2GC7 B;  2OIZ D;  2AGW D;  4FB1 C;  4FAV C;  2AH1 D;  2OK4 D;  2AGY D;  3L4M C;  2J56 L;  3C75 L;  2AGL D;  4Y5R C;  2I0S D;  2IAA B;  2J57 K;  3SLE C;  3PXW C;  2J55 L;  2I0R D;  2MTA L;  4L3H C;  1MAF L;  4O1Q C;  2IUP D;  2Q7Q D;  2HKR D;  3PXS C;  1MAE L;  2HXC D;  4FA5 C;  2AGX D;  2H47 B;  3RN0 C;  4FAN C;  3L4O C;  4K3I C;  3RN1 C;  4L1Q C;  4FA4 C;  2HKM D;  2IUQ D;  2IUV D;  3ORV C;  2AH0 D;  2OJY D;  4L3G C;  2BBK L;  3SJL C;  2I0T D;  3SVW C;  2AGZ D;  1MDA L;  2HJ4 D;  3SWS C;  3RMZ C; 
#chains in the Genus database with same CATH topology
 2OK6 D;  2MAD L;  1MG2 B;  2H3X B;  3SXT C;  3RLM C;  1MG3 B;  4FA9 C;  4FA1 C;  2GC4 B;  2HJB D;  2IUR D;  3PXT C;  2GC7 B;  2OIZ D;  2AGW D;  4FB1 C;  4FAV C;  2AH1 D;  2OK4 D;  2AGY D;  3L4M C;  2J56 L;  3C75 L;  2AGL D;  4Y5R C;  2I0S D;  2IAA B;  2J57 K;  3SLE C;  3PXW C;  2J55 L;  2I0R D;  2MTA L;  4L3H C;  1MAF L;  4O1Q C;  2IUP D;  2Q7Q D;  2HKR D;  3PXS C;  1MAE L;  2HXC D;  4FA5 C;  2AGX D;  2H47 B;  3RN0 C;  4FAN C;  3L4O C;  4K3I C;  3RN1 C;  4L1Q C;  4FA4 C;  2HKM D;  2IUQ D;  2IUV D;  3ORV C;  2AH0 D;  2OJY D;  4L3G C;  2BBK L;  3SJL C;  2I0T D;  3SVW C;  2AGZ D;  1MDA L;  2HJ4 D;  3SWS C;  3RMZ C; 
#chains in the Genus database with same CATH homology
 2OK6 D;  2MAD L;  1MG2 B;  2H3X B;  3SXT C;  3RLM C;  1MG3 B;  4FA9 C;  4FA1 C;  2GC4 B;  2HJB D;  2IUR D;  3PXT C;  2GC7 B;  2OIZ D;  2AGW D;  4FB1 C;  4FAV C;  2AH1 D;  2OK4 D;  2AGY D;  3L4M C;  2J56 L;  3C75 L;  2AGL D;  4Y5R C;  2I0S D;  2IAA B;  2J57 K;  3SLE C;  3PXW C;  2J55 L;  2I0R D;  2MTA L;  4L3H C;  1MAF L;  4O1Q C;  2IUP D;  2Q7Q D;  2HKR D;  3PXS C;  1MAE L;  2HXC D;  4FA5 C;  2AGX D;  2H47 B;  3RN0 C;  4FAN C;  3L4O C;  4K3I C;  3RN1 C;  4L1Q C;  4FA4 C;  2HKM D;  2IUQ D;  2IUV D;  3ORV C;  2AH0 D;  2OJY D;  4L3G C;  2BBK L;  3SJL C;  2I0T D;  3SVW C;  2AGZ D;  1MDA L;  2HJ4 D;  3SWS C;  3RMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...