4FA1C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 130 days.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa1C00
2AGZD 2Q7QD 2AGWD 2AGXD 1MAEL 3L4MC 2HKMD 3SVWC 3SLEC 2HXCD 3RLMC 2IUVD 4FANC 4FA9C 3PXSC 2OK4D 1MAFL 2AH0D 4FA4C 2MADL 2IUQD 2J57K 2AGYD 2H3XB 2J55L 3ORVC 3C75L 4Y5RC 3SJLC 2AH1D 2HJBD 1MDAL 2I0SD 3RN1C 2IURD 4FA1C 2I0TD 2HJ4D 2HKRD 3PXWC 2J56L 4K3IC 2H47B 4L1QC 4FA5C 2OK6D 2I0RD 2OIZD 3RMZC 4L3HC 2IUPD 3SXTC 1MG2B 2BBKL 2OJYD 2AGLD 2GC4B 3L4OC 3RN0C 2MTAL 4FB1C 4O1QC 2GC7B 3SWSC 1MG3B 4FAVC 3PXTC 2IAAB 4L3GC
chains in the Genus database with same CATH superfamily
2AGZD 2Q7QD 2AGWD 2AGXD 1MAEL 3L4MC 2HKMD 3SVWC 3SLEC 2HXCD 3RLMC 2IUVD 4FANC 4FA9C 3PXSC 2OK4D 1MAFL 2AH0D 4FA4C 2MADL 2IUQD 2J57K 2AGYD 2H3XB 2J55L 3ORVC 3C75L 4Y5RC 3SJLC 2AH1D 2HJBD 1MDAL 2I0SD 3RN1C 2IURD 4FA1C 2I0TD 2HJ4D 2HKRD 3PXWC 2J56L 4K3IC 2H47B 4L1QC 4FA5C 2OK6D 2I0RD 2OIZD 3RMZC 4L3HC 2IUPD 3SXTC 1MG2B 2BBKL 2OJYD 2AGLD 2GC4B 3L4OC 3RN0C 2MTAL 4FB1C 4O1QC 2GC7B 3SWSC 1MG3B 4FAVC 3PXTC 2IAAB 4L3GC
chains in the Genus database with same CATH topology
2AGZD 2Q7QD 2AGWD 2AGXD 1MAEL 3L4MC 2HKMD 3SVWC 3SLEC 2HXCD 3RLMC 2IUVD 4FANC 4FA9C 3PXSC 2OK4D 1MAFL 2AH0D 4FA4C 2MADL 2IUQD 2J57K 2AGYD 2H3XB 2J55L 3ORVC 3C75L 4Y5RC 3SJLC 2AH1D 2HJBD 1MDAL 2I0SD 3RN1C 2IURD 4FA1C 2I0TD 2HJ4D 2HKRD 3PXWC 2J56L 4K3IC 2H47B 4L1QC 4FA5C 2OK6D 2I0RD 2OIZD 3RMZC 4L3HC 2IUPD 3SXTC 1MG2B 2BBKL 2OJYD 2AGLD 2GC4B 3L4OC 3RN0C 2MTAL 4FB1C 4O1QC 2GC7B 3SWSC 1MG3B 4FAVC 3PXTC 2IAAB 4L3GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGZ D;  2Q7Q D;  2AGW D;  2AGX D;  1MAE L;  3L4M C;  2HKM D;  3SVW C;  3SLE C;  2HXC D;  3RLM C;  2IUV D;  4FAN C;  4FA9 C;  3PXS C;  2OK4 D;  1MAF L;  2AH0 D;  4FA4 C;  2MAD L;  2IUQ D;  2J57 K;  2AGY D;  2H3X B;  2J55 L;  3ORV C;  3C75 L;  4Y5R C;  3SJL C;  2AH1 D;  2HJB D;  1MDA L;  2I0S D;  3RN1 C;  2IUR D;  4FA1 C;  2I0T D;  2HJ4 D;  2HKR D;  3PXW C;  2J56 L;  4K3I C;  2H47 B;  4L1Q C;  4FA5 C;  2OK6 D;  2I0R D;  2OIZ D;  3RMZ C;  4L3H C;  2IUP D;  3SXT C;  1MG2 B;  2BBK L;  2OJY D;  2AGL D;  2GC4 B;  3L4O C;  3RN0 C;  2MTA L;  4FB1 C;  4O1Q C;  2GC7 B;  3SWS C;  1MG3 B;  4FAV C;  3PXT C;  2IAA B;  4L3G C; 
#chains in the Genus database with same CATH topology
 2AGZ D;  2Q7Q D;  2AGW D;  2AGX D;  1MAE L;  3L4M C;  2HKM D;  3SVW C;  3SLE C;  2HXC D;  3RLM C;  2IUV D;  4FAN C;  4FA9 C;  3PXS C;  2OK4 D;  1MAF L;  2AH0 D;  4FA4 C;  2MAD L;  2IUQ D;  2J57 K;  2AGY D;  2H3X B;  2J55 L;  3ORV C;  3C75 L;  4Y5R C;  3SJL C;  2AH1 D;  2HJB D;  1MDA L;  2I0S D;  3RN1 C;  2IUR D;  4FA1 C;  2I0T D;  2HJ4 D;  2HKR D;  3PXW C;  2J56 L;  4K3I C;  2H47 B;  4L1Q C;  4FA5 C;  2OK6 D;  2I0R D;  2OIZ D;  3RMZ C;  4L3H C;  2IUP D;  3SXT C;  1MG2 B;  2BBK L;  2OJY D;  2AGL D;  2GC4 B;  3L4O C;  3RN0 C;  2MTA L;  4FB1 C;  4O1Q C;  2GC7 B;  3SWS C;  1MG3 B;  4FAV C;  3PXT C;  2IAA B;  4L3G C; 
#chains in the Genus database with same CATH homology
 2AGZ D;  2Q7Q D;  2AGW D;  2AGX D;  1MAE L;  3L4M C;  2HKM D;  3SVW C;  3SLE C;  2HXC D;  3RLM C;  2IUV D;  4FAN C;  4FA9 C;  3PXS C;  2OK4 D;  1MAF L;  2AH0 D;  4FA4 C;  2MAD L;  2IUQ D;  2J57 K;  2AGY D;  2H3X B;  2J55 L;  3ORV C;  3C75 L;  4Y5R C;  3SJL C;  2AH1 D;  2HJB D;  1MDA L;  2I0S D;  3RN1 C;  2IUR D;  4FA1 C;  2I0T D;  2HJ4 D;  2HKR D;  3PXW C;  2J56 L;  4K3I C;  2H47 B;  4L1Q C;  4FA5 C;  2OK6 D;  2I0R D;  2OIZ D;  3RMZ C;  4L3H C;  2IUP D;  3SXT C;  1MG2 B;  2BBK L;  2OJY D;  2AGL D;  2GC4 B;  3L4O C;  3RN0 C;  2MTA L;  4FB1 C;  4O1Q C;  2GC7 B;  3SWS C;  1MG3 B;  4FAV C;  3PXT C;  2IAA B;  4L3G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...