4FA1C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 130 days.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 30
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa1C00
2OJYD 2J57K 4FA9C 2H3XB 2Q7QD 4L3HC 3RMZC 4Y5RC 1MAEL 2IUPD 2AGWD 3PXSC 3RN0C 4FANC 1MDAL 3SWSC 2OIZD 3C75L 4FA5C 2HKMD 3PXTC 1MG3B 2IAAB 4FA4C 2I0SD 3RLMC 2HXCD 2AGYD 4FB1C 2AGXD 1MAFL 3L4OC 2H47B 3SXTC 2I0TD 2IURD 2I0RD 4L3GC 2AGLD 2MTAL 4FA1C 2AH1D 2HKRD 3PXWC 2HJ4D 2HJBD 2OK6D 4O1QC 1MG2B 3ORVC 3SJLC 2J55L 3RN1C 2BBKL 2OK4D 2IUQD 3SLEC 2GC7B 2J56L 4K3IC 2MADL 2GC4B 3L4MC 4FAVC 3SVWC 4L1QC 2IUVD 2AGZD 2AH0D
chains in the Genus database with same CATH superfamily
2OJYD 2J57K 4FA9C 2H3XB 2Q7QD 4L3HC 3RMZC 4Y5RC 1MAEL 2IUPD 2AGWD 3PXSC 3RN0C 4FANC 1MDAL 3SWSC 2OIZD 3C75L 4FA5C 2HKMD 3PXTC 1MG3B 2IAAB 4FA4C 2I0SD 3RLMC 2HXCD 2AGYD 4FB1C 2AGXD 1MAFL 3L4OC 2H47B 3SXTC 2I0TD 2IURD 2I0RD 4L3GC 2AGLD 2MTAL 4FA1C 2AH1D 2HKRD 3PXWC 2HJ4D 2HJBD 2OK6D 4O1QC 1MG2B 3ORVC 3SJLC 2J55L 3RN1C 2BBKL 2OK4D 2IUQD 3SLEC 2GC7B 2J56L 4K3IC 2MADL 2GC4B 3L4MC 4FAVC 3SVWC 4L1QC 2IUVD 2AGZD 2AH0D
chains in the Genus database with same CATH topology
2OJYD 2J57K 4FA9C 2H3XB 2Q7QD 4L3HC 3RMZC 4Y5RC 1MAEL 2IUPD 2AGWD 3PXSC 3RN0C 4FANC 1MDAL 3SWSC 2OIZD 3C75L 4FA5C 2HKMD 3PXTC 1MG3B 2IAAB 4FA4C 2I0SD 3RLMC 2HXCD 2AGYD 4FB1C 2AGXD 1MAFL 3L4OC 2H47B 3SXTC 2I0TD 2IURD 2I0RD 4L3GC 2AGLD 2MTAL 4FA1C 2AH1D 2HKRD 3PXWC 2HJ4D 2HJBD 2OK6D 4O1QC 1MG2B 3ORVC 3SJLC 2J55L 3RN1C 2BBKL 2OK4D 2IUQD 3SLEC 2GC7B 2J56L 4K3IC 2MADL 2GC4B 3L4MC 4FAVC 3SVWC 4L1QC 2IUVD 2AGZD 2AH0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJY D;  2J57 K;  4FA9 C;  2H3X B;  2Q7Q D;  4L3H C;  3RMZ C;  4Y5R C;  1MAE L;  2IUP D;  2AGW D;  3PXS C;  3RN0 C;  4FAN C;  1MDA L;  3SWS C;  2OIZ D;  3C75 L;  4FA5 C;  2HKM D;  3PXT C;  1MG3 B;  2IAA B;  4FA4 C;  2I0S D;  3RLM C;  2HXC D;  2AGY D;  4FB1 C;  2AGX D;  1MAF L;  3L4O C;  2H47 B;  3SXT C;  2I0T D;  2IUR D;  2I0R D;  4L3G C;  2AGL D;  2MTA L;  4FA1 C;  2AH1 D;  2HKR D;  3PXW C;  2HJ4 D;  2HJB D;  2OK6 D;  4O1Q C;  1MG2 B;  3ORV C;  3SJL C;  2J55 L;  3RN1 C;  2BBK L;  2OK4 D;  2IUQ D;  3SLE C;  2GC7 B;  2J56 L;  4K3I C;  2MAD L;  2GC4 B;  3L4M C;  4FAV C;  3SVW C;  4L1Q C;  2IUV D;  2AGZ D;  2AH0 D; 
#chains in the Genus database with same CATH topology
 2OJY D;  2J57 K;  4FA9 C;  2H3X B;  2Q7Q D;  4L3H C;  3RMZ C;  4Y5R C;  1MAE L;  2IUP D;  2AGW D;  3PXS C;  3RN0 C;  4FAN C;  1MDA L;  3SWS C;  2OIZ D;  3C75 L;  4FA5 C;  2HKM D;  3PXT C;  1MG3 B;  2IAA B;  4FA4 C;  2I0S D;  3RLM C;  2HXC D;  2AGY D;  4FB1 C;  2AGX D;  1MAF L;  3L4O C;  2H47 B;  3SXT C;  2I0T D;  2IUR D;  2I0R D;  4L3G C;  2AGL D;  2MTA L;  4FA1 C;  2AH1 D;  2HKR D;  3PXW C;  2HJ4 D;  2HJB D;  2OK6 D;  4O1Q C;  1MG2 B;  3ORV C;  3SJL C;  2J55 L;  3RN1 C;  2BBK L;  2OK4 D;  2IUQ D;  3SLE C;  2GC7 B;  2J56 L;  4K3I C;  2MAD L;  2GC4 B;  3L4M C;  4FAV C;  3SVW C;  4L1Q C;  2IUV D;  2AGZ D;  2AH0 D; 
#chains in the Genus database with same CATH homology
 2OJY D;  2J57 K;  4FA9 C;  2H3X B;  2Q7Q D;  4L3H C;  3RMZ C;  4Y5R C;  1MAE L;  2IUP D;  2AGW D;  3PXS C;  3RN0 C;  4FAN C;  1MDA L;  3SWS C;  2OIZ D;  3C75 L;  4FA5 C;  2HKM D;  3PXT C;  1MG3 B;  2IAA B;  4FA4 C;  2I0S D;  3RLM C;  2HXC D;  2AGY D;  4FB1 C;  2AGX D;  1MAF L;  3L4O C;  2H47 B;  3SXT C;  2I0T D;  2IUR D;  2I0R D;  4L3G C;  2AGL D;  2MTA L;  4FA1 C;  2AH1 D;  2HKR D;  3PXW C;  2HJ4 D;  2HJB D;  2OK6 D;  4O1Q C;  1MG2 B;  3ORV C;  3SJL C;  2J55 L;  3RN1 C;  2BBK L;  2OK4 D;  2IUQ D;  3SLE C;  2GC7 B;  2J56 L;  4K3I C;  2MAD L;  2GC4 B;  3L4M C;  4FAV C;  3SVW C;  4L1Q C;  2IUV D;  2AGZ D;  2AH0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...