4FA1C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 130 days.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa1C00
2OJYD 4L3GC 4FA1C 2GC4B 2HKRD 3PXTC 2AGXD 3C75L 3RN0C 2J55L 2MTAL 4K3IC 2AH0D 3SJLC 4L1QC 3RMZC 2I0SD 1MDAL 2AGWD 2GC7B 3PXSC 3SLEC 2IURD 1MG3B 4FA5C 2HJBD 4O1QC 2AGYD 2MADL 3L4MC 2J57K 4L3HC 2I0TD 4FA4C 2IAAB 2IUVD 3RN1C 2I0RD 2HKMD 4FA9C 2OK4D 3L4OC 3PXWC 2HXCD 2AGLD 4FAVC 2H3XB 1MG2B 3RLMC 2Q7QD 3SWSC 1MAFL 3SXTC 2HJ4D 4FANC 2H47B 2J56L 2OK6D 3SVWC 4Y5RC 1MAEL 2IUPD 3ORVC 2OIZD 2AH1D 2AGZD 2IUQD 2BBKL 4FB1C
chains in the Genus database with same CATH superfamily
2OJYD 4L3GC 4FA1C 2GC4B 2HKRD 3PXTC 2AGXD 3C75L 3RN0C 2J55L 2MTAL 4K3IC 2AH0D 3SJLC 4L1QC 3RMZC 2I0SD 1MDAL 2AGWD 2GC7B 3PXSC 3SLEC 2IURD 1MG3B 4FA5C 2HJBD 4O1QC 2AGYD 2MADL 3L4MC 2J57K 4L3HC 2I0TD 4FA4C 2IAAB 2IUVD 3RN1C 2I0RD 2HKMD 4FA9C 2OK4D 3L4OC 3PXWC 2HXCD 2AGLD 4FAVC 2H3XB 1MG2B 3RLMC 2Q7QD 3SWSC 1MAFL 3SXTC 2HJ4D 4FANC 2H47B 2J56L 2OK6D 3SVWC 4Y5RC 1MAEL 2IUPD 3ORVC 2OIZD 2AH1D 2AGZD 2IUQD 2BBKL 4FB1C
chains in the Genus database with same CATH topology
2OJYD 4L3GC 4FA1C 2GC4B 2HKRD 3PXTC 2AGXD 3C75L 3RN0C 2J55L 2MTAL 4K3IC 2AH0D 3SJLC 4L1QC 3RMZC 2I0SD 1MDAL 2AGWD 2GC7B 3PXSC 3SLEC 2IURD 1MG3B 4FA5C 2HJBD 4O1QC 2AGYD 2MADL 3L4MC 2J57K 4L3HC 2I0TD 4FA4C 2IAAB 2IUVD 3RN1C 2I0RD 2HKMD 4FA9C 2OK4D 3L4OC 3PXWC 2HXCD 2AGLD 4FAVC 2H3XB 1MG2B 3RLMC 2Q7QD 3SWSC 1MAFL 3SXTC 2HJ4D 4FANC 2H47B 2J56L 2OK6D 3SVWC 4Y5RC 1MAEL 2IUPD 3ORVC 2OIZD 2AH1D 2AGZD 2IUQD 2BBKL 4FB1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJY D;  4L3G C;  4FA1 C;  2GC4 B;  2HKR D;  3PXT C;  2AGX D;  3C75 L;  3RN0 C;  2J55 L;  2MTA L;  4K3I C;  2AH0 D;  3SJL C;  4L1Q C;  3RMZ C;  2I0S D;  1MDA L;  2AGW D;  2GC7 B;  3PXS C;  3SLE C;  2IUR D;  1MG3 B;  4FA5 C;  2HJB D;  4O1Q C;  2AGY D;  2MAD L;  3L4M C;  2J57 K;  4L3H C;  2I0T D;  4FA4 C;  2IAA B;  2IUV D;  3RN1 C;  2I0R D;  2HKM D;  4FA9 C;  2OK4 D;  3L4O C;  3PXW C;  2HXC D;  2AGL D;  4FAV C;  2H3X B;  1MG2 B;  3RLM C;  2Q7Q D;  3SWS C;  1MAF L;  3SXT C;  2HJ4 D;  4FAN C;  2H47 B;  2J56 L;  2OK6 D;  3SVW C;  4Y5R C;  1MAE L;  2IUP D;  3ORV C;  2OIZ D;  2AH1 D;  2AGZ D;  2IUQ D;  2BBK L;  4FB1 C; 
#chains in the Genus database with same CATH topology
 2OJY D;  4L3G C;  4FA1 C;  2GC4 B;  2HKR D;  3PXT C;  2AGX D;  3C75 L;  3RN0 C;  2J55 L;  2MTA L;  4K3I C;  2AH0 D;  3SJL C;  4L1Q C;  3RMZ C;  2I0S D;  1MDA L;  2AGW D;  2GC7 B;  3PXS C;  3SLE C;  2IUR D;  1MG3 B;  4FA5 C;  2HJB D;  4O1Q C;  2AGY D;  2MAD L;  3L4M C;  2J57 K;  4L3H C;  2I0T D;  4FA4 C;  2IAA B;  2IUV D;  3RN1 C;  2I0R D;  2HKM D;  4FA9 C;  2OK4 D;  3L4O C;  3PXW C;  2HXC D;  2AGL D;  4FAV C;  2H3X B;  1MG2 B;  3RLM C;  2Q7Q D;  3SWS C;  1MAF L;  3SXT C;  2HJ4 D;  4FAN C;  2H47 B;  2J56 L;  2OK6 D;  3SVW C;  4Y5R C;  1MAE L;  2IUP D;  3ORV C;  2OIZ D;  2AH1 D;  2AGZ D;  2IUQ D;  2BBK L;  4FB1 C; 
#chains in the Genus database with same CATH homology
 2OJY D;  4L3G C;  4FA1 C;  2GC4 B;  2HKR D;  3PXT C;  2AGX D;  3C75 L;  3RN0 C;  2J55 L;  2MTA L;  4K3I C;  2AH0 D;  3SJL C;  4L1Q C;  3RMZ C;  2I0S D;  1MDA L;  2AGW D;  2GC7 B;  3PXS C;  3SLE C;  2IUR D;  1MG3 B;  4FA5 C;  2HJB D;  4O1Q C;  2AGY D;  2MAD L;  3L4M C;  2J57 K;  4L3H C;  2I0T D;  4FA4 C;  2IAA B;  2IUV D;  3RN1 C;  2I0R D;  2HKM D;  4FA9 C;  2OK4 D;  3L4O C;  3PXW C;  2HXC D;  2AGL D;  4FAV C;  2H3X B;  1MG2 B;  3RLM C;  2Q7Q D;  3SWS C;  1MAF L;  3SXT C;  2HJ4 D;  4FAN C;  2H47 B;  2J56 L;  2OK6 D;  3SVW C;  4Y5R C;  1MAE L;  2IUP D;  3ORV C;  2OIZ D;  2AH1 D;  2AGZ D;  2IUQ D;  2BBK L;  4FB1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...