1MG2B

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 34
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 1mg2B00
2H3XB 3ORVC 1MAEL 4FA4C 3RMZC 4L3HC 2HJ4D 3L4MC 2HXCD 4L3GC 2IUPD 4O1QC 2HKRD 2HJBD 4FA1C 2AGXD 2OK4D 3SJLC 2IUVD 2Q7QD 3C75L 3SVWC 2MTAL 3L4OC 4FA9C 2MADL 2BBKL 1MG3B 2I0RD 2J55L 4FB1C 2J56L 3SWSC 2AH1D 3PXWC 2AGYD 2AGLD 4K3IC 1MAFL 3PXTC 2OK6D 1MG2B 2I0SD 3SXTC 3SLEC 3RN0C 4FANC 4Y5RC 3RLMC 1MDAL 2J57K 2AGZD 2HKMD 4FAVC 2OJYD 2I0TD 3PXSC 2IUQD 2OIZD 4L1QC 3RN1C 4FA5C 2IAAB 2H47B 2IURD 2AGWD 2AH0D 2GC7B 2GC4B
chains in the Genus database with same CATH superfamily
2H3XB 3ORVC 1MAEL 4FA4C 3RMZC 4L3HC 2HJ4D 3L4MC 2HXCD 4L3GC 2IUPD 4O1QC 2HKRD 2HJBD 4FA1C 2AGXD 2OK4D 3SJLC 2IUVD 2Q7QD 3C75L 3SVWC 2MTAL 3L4OC 4FA9C 2MADL 2BBKL 1MG3B 2I0RD 2J55L 4FB1C 2J56L 3SWSC 2AH1D 3PXWC 2AGYD 2AGLD 4K3IC 1MAFL 3PXTC 2OK6D 1MG2B 2I0SD 3SXTC 3SLEC 3RN0C 4FANC 4Y5RC 3RLMC 1MDAL 2J57K 2AGZD 2HKMD 4FAVC 2OJYD 2I0TD 3PXSC 2IUQD 2OIZD 4L1QC 3RN1C 4FA5C 2IAAB 2H47B 2IURD 2AGWD 2AH0D 2GC7B 2GC4B
chains in the Genus database with same CATH topology
2H3XB 3ORVC 1MAEL 4FA4C 3RMZC 4L3HC 2HJ4D 3L4MC 2HXCD 4L3GC 2IUPD 4O1QC 2HKRD 2HJBD 4FA1C 2AGXD 2OK4D 3SJLC 2IUVD 2Q7QD 3C75L 3SVWC 2MTAL 3L4OC 4FA9C 2MADL 2BBKL 1MG3B 2I0RD 2J55L 4FB1C 2J56L 3SWSC 2AH1D 3PXWC 2AGYD 2AGLD 4K3IC 1MAFL 3PXTC 2OK6D 1MG2B 2I0SD 3SXTC 3SLEC 3RN0C 4FANC 4Y5RC 3RLMC 1MDAL 2J57K 2AGZD 2HKMD 4FAVC 2OJYD 2I0TD 3PXSC 2IUQD 2OIZD 4L1QC 3RN1C 4FA5C 2IAAB 2H47B 2IURD 2AGWD 2AH0D 2GC7B 2GC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3X B;  3ORV C;  1MAE L;  4FA4 C;  3RMZ C;  4L3H C;  2HJ4 D;  3L4M C;  2HXC D;  4L3G C;  2IUP D;  4O1Q C;  2HKR D;  2HJB D;  4FA1 C;  2AGX D;  2OK4 D;  3SJL C;  2IUV D;  2Q7Q D;  3C75 L;  3SVW C;  2MTA L;  3L4O C;  4FA9 C;  2MAD L;  2BBK L;  1MG3 B;  2I0R D;  2J55 L;  4FB1 C;  2J56 L;  3SWS C;  2AH1 D;  3PXW C;  2AGY D;  2AGL D;  4K3I C;  1MAF L;  3PXT C;  2OK6 D;  1MG2 B;  2I0S D;  3SXT C;  3SLE C;  3RN0 C;  4FAN C;  4Y5R C;  3RLM C;  1MDA L;  2J57 K;  2AGZ D;  2HKM D;  4FAV C;  2OJY D;  2I0T D;  3PXS C;  2IUQ D;  2OIZ D;  4L1Q C;  3RN1 C;  4FA5 C;  2IAA B;  2H47 B;  2IUR D;  2AGW D;  2AH0 D;  2GC7 B;  2GC4 B; 
#chains in the Genus database with same CATH topology
 2H3X B;  3ORV C;  1MAE L;  4FA4 C;  3RMZ C;  4L3H C;  2HJ4 D;  3L4M C;  2HXC D;  4L3G C;  2IUP D;  4O1Q C;  2HKR D;  2HJB D;  4FA1 C;  2AGX D;  2OK4 D;  3SJL C;  2IUV D;  2Q7Q D;  3C75 L;  3SVW C;  2MTA L;  3L4O C;  4FA9 C;  2MAD L;  2BBK L;  1MG3 B;  2I0R D;  2J55 L;  4FB1 C;  2J56 L;  3SWS C;  2AH1 D;  3PXW C;  2AGY D;  2AGL D;  4K3I C;  1MAF L;  3PXT C;  2OK6 D;  1MG2 B;  2I0S D;  3SXT C;  3SLE C;  3RN0 C;  4FAN C;  4Y5R C;  3RLM C;  1MDA L;  2J57 K;  2AGZ D;  2HKM D;  4FAV C;  2OJY D;  2I0T D;  3PXS C;  2IUQ D;  2OIZ D;  4L1Q C;  3RN1 C;  4FA5 C;  2IAA B;  2H47 B;  2IUR D;  2AGW D;  2AH0 D;  2GC7 B;  2GC4 B; 
#chains in the Genus database with same CATH homology
 2H3X B;  3ORV C;  1MAE L;  4FA4 C;  3RMZ C;  4L3H C;  2HJ4 D;  3L4M C;  2HXC D;  4L3G C;  2IUP D;  4O1Q C;  2HKR D;  2HJB D;  4FA1 C;  2AGX D;  2OK4 D;  3SJL C;  2IUV D;  2Q7Q D;  3C75 L;  3SVW C;  2MTA L;  3L4O C;  4FA9 C;  2MAD L;  2BBK L;  1MG3 B;  2I0R D;  2J55 L;  4FB1 C;  2J56 L;  3SWS C;  2AH1 D;  3PXW C;  2AGY D;  2AGL D;  4K3I C;  1MAF L;  3PXT C;  2OK6 D;  1MG2 B;  2I0S D;  3SXT C;  3SLE C;  3RN0 C;  4FAN C;  4Y5R C;  3RLM C;  1MDA L;  2J57 K;  2AGZ D;  2HKM D;  4FAV C;  2OJY D;  2I0T D;  3PXS C;  2IUQ D;  2OIZ D;  4L1Q C;  3RN1 C;  4FA5 C;  2IAA B;  2H47 B;  2IUR D;  2AGW D;  2AH0 D;  2GC7 B;  2GC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...