1MG2B

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 34
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 1mg2B00
4K3IC 2BBKL 2HKMD 2IUPD 3L4MC 2OK6D 2IAAB 2H3XB 2H47B 3ORVC 2AGWD 2I0TD 2I0RD 4FA1C 3SWSC 2AGZD 2IUVD 2J57K 3C75L 3RMZC 2IUQD 3RN0C 2OJYD 4FA9C 2AGLD 3PXWC 2AH0D 4FAVC 3SVWC 2HJBD 3L4OC 2J55L 4FANC 2OIZD 1MG3B 3SLEC 2IURD 4FA5C 2HXCD 2HJ4D 2HKRD 1MG2B 3RLMC 2AGYD 2OK4D 2GC4B 4L3GC 3RN1C 1MDAL 1MAFL 4L1QC 2AGXD 2I0SD 2MTAL 4L3HC 4O1QC 3SJLC 4FB1C 2J56L 4Y5RC 2Q7QD 4FA4C 3PXTC 2GC7B 3SXTC 2AH1D 1MAEL 2MADL 3PXSC
chains in the Genus database with same CATH superfamily
4K3IC 2BBKL 2HKMD 2IUPD 3L4MC 2OK6D 2IAAB 2H3XB 2H47B 3ORVC 2AGWD 2I0TD 2I0RD 4FA1C 3SWSC 2AGZD 2IUVD 2J57K 3C75L 3RMZC 2IUQD 3RN0C 2OJYD 4FA9C 2AGLD 3PXWC 2AH0D 4FAVC 3SVWC 2HJBD 3L4OC 2J55L 4FANC 2OIZD 1MG3B 3SLEC 2IURD 4FA5C 2HXCD 2HJ4D 2HKRD 1MG2B 3RLMC 2AGYD 2OK4D 2GC4B 4L3GC 3RN1C 1MDAL 1MAFL 4L1QC 2AGXD 2I0SD 2MTAL 4L3HC 4O1QC 3SJLC 4FB1C 2J56L 4Y5RC 2Q7QD 4FA4C 3PXTC 2GC7B 3SXTC 2AH1D 1MAEL 2MADL 3PXSC
chains in the Genus database with same CATH topology
4K3IC 2BBKL 2HKMD 2IUPD 3L4MC 2OK6D 2IAAB 2H3XB 2H47B 3ORVC 2AGWD 2I0TD 2I0RD 4FA1C 3SWSC 2AGZD 2IUVD 2J57K 3C75L 3RMZC 2IUQD 3RN0C 2OJYD 4FA9C 2AGLD 3PXWC 2AH0D 4FAVC 3SVWC 2HJBD 3L4OC 2J55L 4FANC 2OIZD 1MG3B 3SLEC 2IURD 4FA5C 2HXCD 2HJ4D 2HKRD 1MG2B 3RLMC 2AGYD 2OK4D 2GC4B 4L3GC 3RN1C 1MDAL 1MAFL 4L1QC 2AGXD 2I0SD 2MTAL 4L3HC 4O1QC 3SJLC 4FB1C 2J56L 4Y5RC 2Q7QD 4FA4C 3PXTC 2GC7B 3SXTC 2AH1D 1MAEL 2MADL 3PXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3I C;  2BBK L;  2HKM D;  2IUP D;  3L4M C;  2OK6 D;  2IAA B;  2H3X B;  2H47 B;  3ORV C;  2AGW D;  2I0T D;  2I0R D;  4FA1 C;  3SWS C;  2AGZ D;  2IUV D;  2J57 K;  3C75 L;  3RMZ C;  2IUQ D;  3RN0 C;  2OJY D;  4FA9 C;  2AGL D;  3PXW C;  2AH0 D;  4FAV C;  3SVW C;  2HJB D;  3L4O C;  2J55 L;  4FAN C;  2OIZ D;  1MG3 B;  3SLE C;  2IUR D;  4FA5 C;  2HXC D;  2HJ4 D;  2HKR D;  1MG2 B;  3RLM C;  2AGY D;  2OK4 D;  2GC4 B;  4L3G C;  3RN1 C;  1MDA L;  1MAF L;  4L1Q C;  2AGX D;  2I0S D;  2MTA L;  4L3H C;  4O1Q C;  3SJL C;  4FB1 C;  2J56 L;  4Y5R C;  2Q7Q D;  4FA4 C;  3PXT C;  2GC7 B;  3SXT C;  2AH1 D;  1MAE L;  2MAD L;  3PXS C; 
#chains in the Genus database with same CATH topology
 4K3I C;  2BBK L;  2HKM D;  2IUP D;  3L4M C;  2OK6 D;  2IAA B;  2H3X B;  2H47 B;  3ORV C;  2AGW D;  2I0T D;  2I0R D;  4FA1 C;  3SWS C;  2AGZ D;  2IUV D;  2J57 K;  3C75 L;  3RMZ C;  2IUQ D;  3RN0 C;  2OJY D;  4FA9 C;  2AGL D;  3PXW C;  2AH0 D;  4FAV C;  3SVW C;  2HJB D;  3L4O C;  2J55 L;  4FAN C;  2OIZ D;  1MG3 B;  3SLE C;  2IUR D;  4FA5 C;  2HXC D;  2HJ4 D;  2HKR D;  1MG2 B;  3RLM C;  2AGY D;  2OK4 D;  2GC4 B;  4L3G C;  3RN1 C;  1MDA L;  1MAF L;  4L1Q C;  2AGX D;  2I0S D;  2MTA L;  4L3H C;  4O1Q C;  3SJL C;  4FB1 C;  2J56 L;  4Y5R C;  2Q7Q D;  4FA4 C;  3PXT C;  2GC7 B;  3SXT C;  2AH1 D;  1MAE L;  2MAD L;  3PXS C; 
#chains in the Genus database with same CATH homology
 4K3I C;  2BBK L;  2HKM D;  2IUP D;  3L4M C;  2OK6 D;  2IAA B;  2H3X B;  2H47 B;  3ORV C;  2AGW D;  2I0T D;  2I0R D;  4FA1 C;  3SWS C;  2AGZ D;  2IUV D;  2J57 K;  3C75 L;  3RMZ C;  2IUQ D;  3RN0 C;  2OJY D;  4FA9 C;  2AGL D;  3PXW C;  2AH0 D;  4FAV C;  3SVW C;  2HJB D;  3L4O C;  2J55 L;  4FAN C;  2OIZ D;  1MG3 B;  3SLE C;  2IUR D;  4FA5 C;  2HXC D;  2HJ4 D;  2HKR D;  1MG2 B;  3RLM C;  2AGY D;  2OK4 D;  2GC4 B;  4L3G C;  3RN1 C;  1MDA L;  1MAF L;  4L1Q C;  2AGX D;  2I0S D;  2MTA L;  4L3H C;  4O1Q C;  3SJL C;  4FB1 C;  2J56 L;  4Y5R C;  2Q7Q D;  4FA4 C;  3PXT C;  2GC7 B;  3SXT C;  2AH1 D;  1MAE L;  2MAD L;  3PXS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...