3PXWC

Crystal structure of ferrous no adduct of maug in complex with pre-methylamine dehydrogenase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxwC00
2OK6D 3SWSC 3SVWC 2Q7QD 2H47B 4FA9C 2I0RD 3SLEC 3RLMC 2AGWD 1MG2B 1MAEL 1MAFL 3RN1C 4Y5RC 3PXWC 3PXSC 2J55L 2IURD 4L1QC 3SJLC 2HKRD 4FA1C 2AGXD 4L3GC 2HJ4D 1MG3B 2HJBD 2MTAL 2OK4D 2AGZD 3C75L 4FAVC 2AGYD 4O1QC 3PXTC 4FANC 2GC4B 1MDAL 2MADL 3L4OC 2BBKL 2OJYD 3SXTC 2J56L 2AH1D 3RMZC 2AGLD 2AH0D 2I0TD 4L3HC 3RN0C 4FA4C 3ORVC 3L4MC 4K3IC 4FB1C 2IUPD 4FA5C 2H3XB 2I0SD 2HXCD 2OIZD 2IUVD 2GC7B 2IAAB 2HKMD 2IUQD 2J57K
chains in the Genus database with same CATH superfamily
2OK6D 3SWSC 3SVWC 2Q7QD 2H47B 4FA9C 2I0RD 3SLEC 3RLMC 2AGWD 1MG2B 1MAEL 1MAFL 3RN1C 4Y5RC 3PXWC 3PXSC 2J55L 2IURD 4L1QC 3SJLC 2HKRD 4FA1C 2AGXD 4L3GC 2HJ4D 1MG3B 2HJBD 2MTAL 2OK4D 2AGZD 3C75L 4FAVC 2AGYD 4O1QC 3PXTC 4FANC 2GC4B 1MDAL 2MADL 3L4OC 2BBKL 2OJYD 3SXTC 2J56L 2AH1D 3RMZC 2AGLD 2AH0D 2I0TD 4L3HC 3RN0C 4FA4C 3ORVC 3L4MC 4K3IC 4FB1C 2IUPD 4FA5C 2H3XB 2I0SD 2HXCD 2OIZD 2IUVD 2GC7B 2IAAB 2HKMD 2IUQD 2J57K
chains in the Genus database with same CATH topology
2OK6D 3SWSC 3SVWC 2Q7QD 2H47B 4FA9C 2I0RD 3SLEC 3RLMC 2AGWD 1MG2B 1MAEL 1MAFL 3RN1C 4Y5RC 3PXWC 3PXSC 2J55L 2IURD 4L1QC 3SJLC 2HKRD 4FA1C 2AGXD 4L3GC 2HJ4D 1MG3B 2HJBD 2MTAL 2OK4D 2AGZD 3C75L 4FAVC 2AGYD 4O1QC 3PXTC 4FANC 2GC4B 1MDAL 2MADL 3L4OC 2BBKL 2OJYD 3SXTC 2J56L 2AH1D 3RMZC 2AGLD 2AH0D 2I0TD 4L3HC 3RN0C 4FA4C 3ORVC 3L4MC 4K3IC 4FB1C 2IUPD 4FA5C 2H3XB 2I0SD 2HXCD 2OIZD 2IUVD 2GC7B 2IAAB 2HKMD 2IUQD 2J57K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK6 D;  3SWS C;  3SVW C;  2Q7Q D;  2H47 B;  4FA9 C;  2I0R D;  3SLE C;  3RLM C;  2AGW D;  1MG2 B;  1MAE L;  1MAF L;  3RN1 C;  4Y5R C;  3PXW C;  3PXS C;  2J55 L;  2IUR D;  4L1Q C;  3SJL C;  2HKR D;  4FA1 C;  2AGX D;  4L3G C;  2HJ4 D;  1MG3 B;  2HJB D;  2MTA L;  2OK4 D;  2AGZ D;  3C75 L;  4FAV C;  2AGY D;  4O1Q C;  3PXT C;  4FAN C;  2GC4 B;  1MDA L;  2MAD L;  3L4O C;  2BBK L;  2OJY D;  3SXT C;  2J56 L;  2AH1 D;  3RMZ C;  2AGL D;  2AH0 D;  2I0T D;  4L3H C;  3RN0 C;  4FA4 C;  3ORV C;  3L4M C;  4K3I C;  4FB1 C;  2IUP D;  4FA5 C;  2H3X B;  2I0S D;  2HXC D;  2OIZ D;  2IUV D;  2GC7 B;  2IAA B;  2HKM D;  2IUQ D;  2J57 K; 
#chains in the Genus database with same CATH topology
 2OK6 D;  3SWS C;  3SVW C;  2Q7Q D;  2H47 B;  4FA9 C;  2I0R D;  3SLE C;  3RLM C;  2AGW D;  1MG2 B;  1MAE L;  1MAF L;  3RN1 C;  4Y5R C;  3PXW C;  3PXS C;  2J55 L;  2IUR D;  4L1Q C;  3SJL C;  2HKR D;  4FA1 C;  2AGX D;  4L3G C;  2HJ4 D;  1MG3 B;  2HJB D;  2MTA L;  2OK4 D;  2AGZ D;  3C75 L;  4FAV C;  2AGY D;  4O1Q C;  3PXT C;  4FAN C;  2GC4 B;  1MDA L;  2MAD L;  3L4O C;  2BBK L;  2OJY D;  3SXT C;  2J56 L;  2AH1 D;  3RMZ C;  2AGL D;  2AH0 D;  2I0T D;  4L3H C;  3RN0 C;  4FA4 C;  3ORV C;  3L4M C;  4K3I C;  4FB1 C;  2IUP D;  4FA5 C;  2H3X B;  2I0S D;  2HXC D;  2OIZ D;  2IUV D;  2GC7 B;  2IAA B;  2HKM D;  2IUQ D;  2J57 K; 
#chains in the Genus database with same CATH homology
 2OK6 D;  3SWS C;  3SVW C;  2Q7Q D;  2H47 B;  4FA9 C;  2I0R D;  3SLE C;  3RLM C;  2AGW D;  1MG2 B;  1MAE L;  1MAF L;  3RN1 C;  4Y5R C;  3PXW C;  3PXS C;  2J55 L;  2IUR D;  4L1Q C;  3SJL C;  2HKR D;  4FA1 C;  2AGX D;  4L3G C;  2HJ4 D;  1MG3 B;  2HJB D;  2MTA L;  2OK4 D;  2AGZ D;  3C75 L;  4FAV C;  2AGY D;  4O1Q C;  3PXT C;  4FAN C;  2GC4 B;  1MDA L;  2MAD L;  3L4O C;  2BBK L;  2OJY D;  3SXT C;  2J56 L;  2AH1 D;  3RMZ C;  2AGL D;  2AH0 D;  2I0T D;  4L3H C;  3RN0 C;  4FA4 C;  3ORV C;  3L4M C;  4K3I C;  4FB1 C;  2IUP D;  4FA5 C;  2H3X B;  2I0S D;  2HXC D;  2OIZ D;  2IUV D;  2GC7 B;  2IAA B;  2HKM D;  2IUQ D;  2J57 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...