3PXWC

Crystal structure of ferrous no adduct of maug in complex with pre-methylamine dehydrogenase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxwC00
4FA5C 1MG2B 2HKRD 2HJ4D 2IAAB 2I0SD 3C75L 2HXCD 4FB1C 2J56L 3SWSC 4FA9C 2J57K 3L4MC 4L1QC 2Q7QD 3SVWC 2OIZD 2AGZD 1MAFL 2MTAL 4FAVC 2OK4D 2AGWD 2IUVD 4O1QC 3SJLC 2IURD 2H47B 2HKMD 3RLMC 3RN1C 4FANC 2OJYD 1MG3B 2OK6D 3PXTC 2IUQD 2AGYD 3RN0C 2HJBD 2BBKL 4L3GC 2AGLD 2AGXD 4Y5RC 1MAEL 2GC4B 4FA1C 4K3IC 4FA4C 3ORVC 3PXSC 3RMZC 4L3HC 3SXTC 3PXWC 3L4OC 2H3XB 2AH1D 2AH0D 3SLEC 2MADL 1MDAL 2J55L 2I0RD 2IUPD 2I0TD 2GC7B
chains in the Genus database with same CATH superfamily
4FA5C 1MG2B 2HKRD 2HJ4D 2IAAB 2I0SD 3C75L 2HXCD 4FB1C 2J56L 3SWSC 4FA9C 2J57K 3L4MC 4L1QC 2Q7QD 3SVWC 2OIZD 2AGZD 1MAFL 2MTAL 4FAVC 2OK4D 2AGWD 2IUVD 4O1QC 3SJLC 2IURD 2H47B 2HKMD 3RLMC 3RN1C 4FANC 2OJYD 1MG3B 2OK6D 3PXTC 2IUQD 2AGYD 3RN0C 2HJBD 2BBKL 4L3GC 2AGLD 2AGXD 4Y5RC 1MAEL 2GC4B 4FA1C 4K3IC 4FA4C 3ORVC 3PXSC 3RMZC 4L3HC 3SXTC 3PXWC 3L4OC 2H3XB 2AH1D 2AH0D 3SLEC 2MADL 1MDAL 2J55L 2I0RD 2IUPD 2I0TD 2GC7B
chains in the Genus database with same CATH topology
4FA5C 1MG2B 2HKRD 2HJ4D 2IAAB 2I0SD 3C75L 2HXCD 4FB1C 2J56L 3SWSC 4FA9C 2J57K 3L4MC 4L1QC 2Q7QD 3SVWC 2OIZD 2AGZD 1MAFL 2MTAL 4FAVC 2OK4D 2AGWD 2IUVD 4O1QC 3SJLC 2IURD 2H47B 2HKMD 3RLMC 3RN1C 4FANC 2OJYD 1MG3B 2OK6D 3PXTC 2IUQD 2AGYD 3RN0C 2HJBD 2BBKL 4L3GC 2AGLD 2AGXD 4Y5RC 1MAEL 2GC4B 4FA1C 4K3IC 4FA4C 3ORVC 3PXSC 3RMZC 4L3HC 3SXTC 3PXWC 3L4OC 2H3XB 2AH1D 2AH0D 3SLEC 2MADL 1MDAL 2J55L 2I0RD 2IUPD 2I0TD 2GC7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA5 C;  1MG2 B;  2HKR D;  2HJ4 D;  2IAA B;  2I0S D;  3C75 L;  2HXC D;  4FB1 C;  2J56 L;  3SWS C;  4FA9 C;  2J57 K;  3L4M C;  4L1Q C;  2Q7Q D;  3SVW C;  2OIZ D;  2AGZ D;  1MAF L;  2MTA L;  4FAV C;  2OK4 D;  2AGW D;  2IUV D;  4O1Q C;  3SJL C;  2IUR D;  2H47 B;  2HKM D;  3RLM C;  3RN1 C;  4FAN C;  2OJY D;  1MG3 B;  2OK6 D;  3PXT C;  2IUQ D;  2AGY D;  3RN0 C;  2HJB D;  2BBK L;  4L3G C;  2AGL D;  2AGX D;  4Y5R C;  1MAE L;  2GC4 B;  4FA1 C;  4K3I C;  4FA4 C;  3ORV C;  3PXS C;  3RMZ C;  4L3H C;  3SXT C;  3PXW C;  3L4O C;  2H3X B;  2AH1 D;  2AH0 D;  3SLE C;  2MAD L;  1MDA L;  2J55 L;  2I0R D;  2IUP D;  2I0T D;  2GC7 B; 
#chains in the Genus database with same CATH topology
 4FA5 C;  1MG2 B;  2HKR D;  2HJ4 D;  2IAA B;  2I0S D;  3C75 L;  2HXC D;  4FB1 C;  2J56 L;  3SWS C;  4FA9 C;  2J57 K;  3L4M C;  4L1Q C;  2Q7Q D;  3SVW C;  2OIZ D;  2AGZ D;  1MAF L;  2MTA L;  4FAV C;  2OK4 D;  2AGW D;  2IUV D;  4O1Q C;  3SJL C;  2IUR D;  2H47 B;  2HKM D;  3RLM C;  3RN1 C;  4FAN C;  2OJY D;  1MG3 B;  2OK6 D;  3PXT C;  2IUQ D;  2AGY D;  3RN0 C;  2HJB D;  2BBK L;  4L3G C;  2AGL D;  2AGX D;  4Y5R C;  1MAE L;  2GC4 B;  4FA1 C;  4K3I C;  4FA4 C;  3ORV C;  3PXS C;  3RMZ C;  4L3H C;  3SXT C;  3PXW C;  3L4O C;  2H3X B;  2AH1 D;  2AH0 D;  3SLE C;  2MAD L;  1MDA L;  2J55 L;  2I0R D;  2IUP D;  2I0T D;  2GC7 B; 
#chains in the Genus database with same CATH homology
 4FA5 C;  1MG2 B;  2HKR D;  2HJ4 D;  2IAA B;  2I0S D;  3C75 L;  2HXC D;  4FB1 C;  2J56 L;  3SWS C;  4FA9 C;  2J57 K;  3L4M C;  4L1Q C;  2Q7Q D;  3SVW C;  2OIZ D;  2AGZ D;  1MAF L;  2MTA L;  4FAV C;  2OK4 D;  2AGW D;  2IUV D;  4O1Q C;  3SJL C;  2IUR D;  2H47 B;  2HKM D;  3RLM C;  3RN1 C;  4FAN C;  2OJY D;  1MG3 B;  2OK6 D;  3PXT C;  2IUQ D;  2AGY D;  3RN0 C;  2HJB D;  2BBK L;  4L3G C;  2AGL D;  2AGX D;  4Y5R C;  1MAE L;  2GC4 B;  4FA1 C;  4K3I C;  4FA4 C;  3ORV C;  3PXS C;  3RMZ C;  4L3H C;  3SXT C;  3PXW C;  3L4O C;  2H3X B;  2AH1 D;  2AH0 D;  3SLE C;  2MAD L;  1MDA L;  2J55 L;  2I0R D;  2IUP D;  2I0T D;  2GC7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...