The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
125
|
structure length |
124
|
Chain Sequence |
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Oxidoreductase/electron transport
|
molecule keywords |
Methylamine utilization protein MauG
|
publication title |
Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb |
source organism |
Paracoccus denitrificans
|
total genus |
31
|
structure length |
124
|
sequence length |
125
|
chains with identical sequence |
E
|
ec nomenclature |
ec
1.4.9.1: Methylamine dehydrogenase (amicyanin). |
pdb deposition date | 2010-12-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
C | PF02975 | Me-amine-dh_L | Methylamine dehydrogenase, L chain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Electron Transport Ethylamine Dehydrogenase | Methylamine/Aralkylamine dehydrogenase light chain |
#chains in the Genus database with same CATH superfamily 4FB1 C; 2BBK L; 2I0S D; 2IUQ D; 3RLM C; 2IUR D; 2AGW D; 2AGY D; 2Q7Q D; 3RN0 C; 1MDA L; 2HJB D; 3SVW C; 3PXT C; 1MG2 B; 2MTA L; 3L4M C; 4FA4 C; 1MAE L; 2OK4 D; 2J57 K; 3PXS C; 2OK6 D; 3ORV C; 4K3I C; 2GC4 B; 2HKM D; 3RN1 C; 2GC7 B; 1MG3 B; 2I0R D; 2J55 L; 2IUP D; 3RMZ C; 4O1Q C; 2H3X B; 2AH0 D; 2OIZ D; 3C75 L; 4L1Q C; 2AGX D; 2MAD L; 3SWS C; 3SJL C; 2I0T D; 2AH1 D; 4L3G C; 4L3H C; 3SLE C; 1MAF L; 4Y5R C; 2IAA B; 2HKR D; 2H47 B; 2OJY D; 4FAV C; 3PXW C; 2HXC D; 2AGL D; 4FA1 C; 2J56 L; 4FA5 C; 4FA9 C; 3L4O C; 2HJ4 D; 2AGZ D; 3SXT C; 4FAN C; 2IUV D; #chains in the Genus database with same CATH topology 4FB1 C; 2BBK L; 2I0S D; 2IUQ D; 3RLM C; 2IUR D; 2AGW D; 2AGY D; 2Q7Q D; 3RN0 C; 1MDA L; 2HJB D; 3SVW C; 3PXT C; 1MG2 B; 2MTA L; 3L4M C; 4FA4 C; 1MAE L; 2OK4 D; 2J57 K; 3PXS C; 2OK6 D; 3ORV C; 4K3I C; 2GC4 B; 2HKM D; 3RN1 C; 2GC7 B; 1MG3 B; 2I0R D; 2J55 L; 2IUP D; 3RMZ C; 4O1Q C; 2H3X B; 2AH0 D; 2OIZ D; 3C75 L; 4L1Q C; 2AGX D; 2MAD L; 3SWS C; 3SJL C; 2I0T D; 2AH1 D; 4L3G C; 4L3H C; 3SLE C; 1MAF L; 4Y5R C; 2IAA B; 2HKR D; 2H47 B; 2OJY D; 4FAV C; 3PXW C; 2HXC D; 2AGL D; 4FA1 C; 2J56 L; 4FA5 C; 4FA9 C; 3L4O C; 2HJ4 D; 2AGZ D; 3SXT C; 4FAN C; 2IUV D; #chains in the Genus database with same CATH homology 4FB1 C; 2BBK L; 2I0S D; 2IUQ D; 3RLM C; 2IUR D; 2AGW D; 2AGY D; 2Q7Q D; 3RN0 C; 1MDA L; 2HJB D; 3SVW C; 3PXT C; 1MG2 B; 2MTA L; 3L4M C; 4FA4 C; 1MAE L; 2OK4 D; 2J57 K; 3PXS C; 2OK6 D; 3ORV C; 4K3I C; 2GC4 B; 2HKM D; 3RN1 C; 2GC7 B; 1MG3 B; 2I0R D; 2J55 L; 2IUP D; 3RMZ C; 4O1Q C; 2H3X B; 2AH0 D; 2OIZ D; 3C75 L; 4L1Q C; 2AGX D; 2MAD L; 3SWS C; 3SJL C; 2I0T D; 2AH1 D; 4L3G C; 4L3H C; 3SLE C; 1MAF L; 4Y5R C; 2IAA B; 2HKR D; 2H47 B; 2OJY D; 4FAV C; 3PXW C; 2HXC D; 2AGL D; 4FA1 C; 2J56 L; 4FA5 C; 4FA9 C; 3L4O C; 2HJ4 D; 2AGZ D; 3SXT C; 4FAN C; 2IUV D;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...