3PXWC

Crystal structure of ferrous no adduct of maug in complex with pre-methylamine dehydrogenase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxwC00
4FA1C 1MAEL 2HJBD 2I0TD 2IAAB 3RLMC 3SJLC 2H47B 2IUPD 3RN0C 4FANC 2AGYD 1MG2B 2J57K 2MTAL 4K3IC 2J55L 2OIZD 4L1QC 1MG3B 2GC7B 1MAFL 2GC4B 2Q7QD 2OK6D 3PXSC 3SWSC 2AGXD 2MADL 2J56L 2OJYD 3C75L 3L4OC 3PXTC 2AGZD 1MDAL 2AGWD 3SLEC 4FA5C 3RMZC 3PXWC 3RN1C 2H3XB 2BBKL 2HKRD 2AH0D 2OK4D 4FA9C 3SXTC 4FB1C 4FAVC 2HXCD 2IUVD 2HKMD 3ORVC 2HJ4D 4L3GC 4Y5RC 2I0SD 3L4MC 2AGLD 3SVWC 2I0RD 4FA4C 2IURD 4O1QC 4L3HC 2AH1D 2IUQD
chains in the Genus database with same CATH superfamily
4FA1C 1MAEL 2HJBD 2I0TD 2IAAB 3RLMC 3SJLC 2H47B 2IUPD 3RN0C 4FANC 2AGYD 1MG2B 2J57K 2MTAL 4K3IC 2J55L 2OIZD 4L1QC 1MG3B 2GC7B 1MAFL 2GC4B 2Q7QD 2OK6D 3PXSC 3SWSC 2AGXD 2MADL 2J56L 2OJYD 3C75L 3L4OC 3PXTC 2AGZD 1MDAL 2AGWD 3SLEC 4FA5C 3RMZC 3PXWC 3RN1C 2H3XB 2BBKL 2HKRD 2AH0D 2OK4D 4FA9C 3SXTC 4FB1C 4FAVC 2HXCD 2IUVD 2HKMD 3ORVC 2HJ4D 4L3GC 4Y5RC 2I0SD 3L4MC 2AGLD 3SVWC 2I0RD 4FA4C 2IURD 4O1QC 4L3HC 2AH1D 2IUQD
chains in the Genus database with same CATH topology
4FA1C 1MAEL 2HJBD 2I0TD 2IAAB 3RLMC 3SJLC 2H47B 2IUPD 3RN0C 4FANC 2AGYD 1MG2B 2J57K 2MTAL 4K3IC 2J55L 2OIZD 4L1QC 1MG3B 2GC7B 1MAFL 2GC4B 2Q7QD 2OK6D 3PXSC 3SWSC 2AGXD 2MADL 2J56L 2OJYD 3C75L 3L4OC 3PXTC 2AGZD 1MDAL 2AGWD 3SLEC 4FA5C 3RMZC 3PXWC 3RN1C 2H3XB 2BBKL 2HKRD 2AH0D 2OK4D 4FA9C 3SXTC 4FB1C 4FAVC 2HXCD 2IUVD 2HKMD 3ORVC 2HJ4D 4L3GC 4Y5RC 2I0SD 3L4MC 2AGLD 3SVWC 2I0RD 4FA4C 2IURD 4O1QC 4L3HC 2AH1D 2IUQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA1 C;  1MAE L;  2HJB D;  2I0T D;  2IAA B;  3RLM C;  3SJL C;  2H47 B;  2IUP D;  3RN0 C;  4FAN C;  2AGY D;  1MG2 B;  2J57 K;  2MTA L;  4K3I C;  2J55 L;  2OIZ D;  4L1Q C;  1MG3 B;  2GC7 B;  1MAF L;  2GC4 B;  2Q7Q D;  2OK6 D;  3PXS C;  3SWS C;  2AGX D;  2MAD L;  2J56 L;  2OJY D;  3C75 L;  3L4O C;  3PXT C;  2AGZ D;  1MDA L;  2AGW D;  3SLE C;  4FA5 C;  3RMZ C;  3PXW C;  3RN1 C;  2H3X B;  2BBK L;  2HKR D;  2AH0 D;  2OK4 D;  4FA9 C;  3SXT C;  4FB1 C;  4FAV C;  2HXC D;  2IUV D;  2HKM D;  3ORV C;  2HJ4 D;  4L3G C;  4Y5R C;  2I0S D;  3L4M C;  2AGL D;  3SVW C;  2I0R D;  4FA4 C;  2IUR D;  4O1Q C;  4L3H C;  2AH1 D;  2IUQ D; 
#chains in the Genus database with same CATH topology
 4FA1 C;  1MAE L;  2HJB D;  2I0T D;  2IAA B;  3RLM C;  3SJL C;  2H47 B;  2IUP D;  3RN0 C;  4FAN C;  2AGY D;  1MG2 B;  2J57 K;  2MTA L;  4K3I C;  2J55 L;  2OIZ D;  4L1Q C;  1MG3 B;  2GC7 B;  1MAF L;  2GC4 B;  2Q7Q D;  2OK6 D;  3PXS C;  3SWS C;  2AGX D;  2MAD L;  2J56 L;  2OJY D;  3C75 L;  3L4O C;  3PXT C;  2AGZ D;  1MDA L;  2AGW D;  3SLE C;  4FA5 C;  3RMZ C;  3PXW C;  3RN1 C;  2H3X B;  2BBK L;  2HKR D;  2AH0 D;  2OK4 D;  4FA9 C;  3SXT C;  4FB1 C;  4FAV C;  2HXC D;  2IUV D;  2HKM D;  3ORV C;  2HJ4 D;  4L3G C;  4Y5R C;  2I0S D;  3L4M C;  2AGL D;  3SVW C;  2I0R D;  4FA4 C;  2IUR D;  4O1Q C;  4L3H C;  2AH1 D;  2IUQ D; 
#chains in the Genus database with same CATH homology
 4FA1 C;  1MAE L;  2HJB D;  2I0T D;  2IAA B;  3RLM C;  3SJL C;  2H47 B;  2IUP D;  3RN0 C;  4FAN C;  2AGY D;  1MG2 B;  2J57 K;  2MTA L;  4K3I C;  2J55 L;  2OIZ D;  4L1Q C;  1MG3 B;  2GC7 B;  1MAF L;  2GC4 B;  2Q7Q D;  2OK6 D;  3PXS C;  3SWS C;  2AGX D;  2MAD L;  2J56 L;  2OJY D;  3C75 L;  3L4O C;  3PXT C;  2AGZ D;  1MDA L;  2AGW D;  3SLE C;  4FA5 C;  3RMZ C;  3PXW C;  3RN1 C;  2H3X B;  2BBK L;  2HKR D;  2AH0 D;  2OK4 D;  4FA9 C;  3SXT C;  4FB1 C;  4FAV C;  2HXC D;  2IUV D;  2HKM D;  3ORV C;  2HJ4 D;  4L3G C;  4Y5R C;  2I0S D;  3L4M C;  2AGL D;  3SVW C;  2I0R D;  4FA4 C;  2IUR D;  4O1Q C;  4L3H C;  2AH1 D;  2IUQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...