2MTAL

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 29
structure length 124
sequence length 125
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2mtaL00
2AGZD 3SXTC 1MG3B 4L3GC 2J57K 2HKMD 2OK6D 3SJLC 2H3XB 1MAFL 1MAEL 2AH0D 3SWSC 2OJYD 2IAAB 2IUPD 2AGWD 3RN0C 4L1QC 2HJ4D 2IUVD 2HJBD 3SLEC 1MG2B 3RN1C 2I0SD 2AGYD 3RMZC 4FA1C 4FANC 2Q7QD 2AH1D 2OIZD 2H47B 2MTAL 2IUQD 4L3HC 3PXTC 4FAVC 4FA4C 3PXSC 4K3IC 2AGLD 2I0TD 3C75L 4FA5C 3L4MC 2OK4D 1MDAL 2I0RD 2IURD 4FB1C 3SVWC 2MADL 3ORVC 2BBKL 2HKRD 4FA9C 2J55L 3PXWC 3RLMC 2HXCD 2J56L 3L4OC 4Y5RC 4O1QC 2AGXD 2GC4B 2GC7B
chains in the Genus database with same CATH superfamily
2AGZD 3SXTC 1MG3B 4L3GC 2J57K 2HKMD 2OK6D 3SJLC 2H3XB 1MAFL 1MAEL 2AH0D 3SWSC 2OJYD 2IAAB 2IUPD 2AGWD 3RN0C 4L1QC 2HJ4D 2IUVD 2HJBD 3SLEC 1MG2B 3RN1C 2I0SD 2AGYD 3RMZC 4FA1C 4FANC 2Q7QD 2AH1D 2OIZD 2H47B 2MTAL 2IUQD 4L3HC 3PXTC 4FAVC 4FA4C 3PXSC 4K3IC 2AGLD 2I0TD 3C75L 4FA5C 3L4MC 2OK4D 1MDAL 2I0RD 2IURD 4FB1C 3SVWC 2MADL 3ORVC 2BBKL 2HKRD 4FA9C 2J55L 3PXWC 3RLMC 2HXCD 2J56L 3L4OC 4Y5RC 4O1QC 2AGXD 2GC4B 2GC7B
chains in the Genus database with same CATH topology
2AGZD 3SXTC 1MG3B 4L3GC 2J57K 2HKMD 2OK6D 3SJLC 2H3XB 1MAFL 1MAEL 2AH0D 3SWSC 2OJYD 2IAAB 2IUPD 2AGWD 3RN0C 4L1QC 2HJ4D 2IUVD 2HJBD 3SLEC 1MG2B 3RN1C 2I0SD 2AGYD 3RMZC 4FA1C 4FANC 2Q7QD 2AH1D 2OIZD 2H47B 2MTAL 2IUQD 4L3HC 3PXTC 4FAVC 4FA4C 3PXSC 4K3IC 2AGLD 2I0TD 3C75L 4FA5C 3L4MC 2OK4D 1MDAL 2I0RD 2IURD 4FB1C 3SVWC 2MADL 3ORVC 2BBKL 2HKRD 4FA9C 2J55L 3PXWC 3RLMC 2HXCD 2J56L 3L4OC 4Y5RC 4O1QC 2AGXD 2GC4B 2GC7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGZ D;  3SXT C;  1MG3 B;  4L3G C;  2J57 K;  2HKM D;  2OK6 D;  3SJL C;  2H3X B;  1MAF L;  1MAE L;  2AH0 D;  3SWS C;  2OJY D;  2IAA B;  2IUP D;  2AGW D;  3RN0 C;  4L1Q C;  2HJ4 D;  2IUV D;  2HJB D;  3SLE C;  1MG2 B;  3RN1 C;  2I0S D;  2AGY D;  3RMZ C;  4FA1 C;  4FAN C;  2Q7Q D;  2AH1 D;  2OIZ D;  2H47 B;  2MTA L;  2IUQ D;  4L3H C;  3PXT C;  4FAV C;  4FA4 C;  3PXS C;  4K3I C;  2AGL D;  2I0T D;  3C75 L;  4FA5 C;  3L4M C;  2OK4 D;  1MDA L;  2I0R D;  2IUR D;  4FB1 C;  3SVW C;  2MAD L;  3ORV C;  2BBK L;  2HKR D;  4FA9 C;  2J55 L;  3PXW C;  3RLM C;  2HXC D;  2J56 L;  3L4O C;  4Y5R C;  4O1Q C;  2AGX D;  2GC4 B;  2GC7 B; 
#chains in the Genus database with same CATH topology
 2AGZ D;  3SXT C;  1MG3 B;  4L3G C;  2J57 K;  2HKM D;  2OK6 D;  3SJL C;  2H3X B;  1MAF L;  1MAE L;  2AH0 D;  3SWS C;  2OJY D;  2IAA B;  2IUP D;  2AGW D;  3RN0 C;  4L1Q C;  2HJ4 D;  2IUV D;  2HJB D;  3SLE C;  1MG2 B;  3RN1 C;  2I0S D;  2AGY D;  3RMZ C;  4FA1 C;  4FAN C;  2Q7Q D;  2AH1 D;  2OIZ D;  2H47 B;  2MTA L;  2IUQ D;  4L3H C;  3PXT C;  4FAV C;  4FA4 C;  3PXS C;  4K3I C;  2AGL D;  2I0T D;  3C75 L;  4FA5 C;  3L4M C;  2OK4 D;  1MDA L;  2I0R D;  2IUR D;  4FB1 C;  3SVW C;  2MAD L;  3ORV C;  2BBK L;  2HKR D;  4FA9 C;  2J55 L;  3PXW C;  3RLM C;  2HXC D;  2J56 L;  3L4O C;  4Y5R C;  4O1Q C;  2AGX D;  2GC4 B;  2GC7 B; 
#chains in the Genus database with same CATH homology
 2AGZ D;  3SXT C;  1MG3 B;  4L3G C;  2J57 K;  2HKM D;  2OK6 D;  3SJL C;  2H3X B;  1MAF L;  1MAE L;  2AH0 D;  3SWS C;  2OJY D;  2IAA B;  2IUP D;  2AGW D;  3RN0 C;  4L1Q C;  2HJ4 D;  2IUV D;  2HJB D;  3SLE C;  1MG2 B;  3RN1 C;  2I0S D;  2AGY D;  3RMZ C;  4FA1 C;  4FAN C;  2Q7Q D;  2AH1 D;  2OIZ D;  2H47 B;  2MTA L;  2IUQ D;  4L3H C;  3PXT C;  4FAV C;  4FA4 C;  3PXS C;  4K3I C;  2AGL D;  2I0T D;  3C75 L;  4FA5 C;  3L4M C;  2OK4 D;  1MDA L;  2I0R D;  2IUR D;  4FB1 C;  3SVW C;  2MAD L;  3ORV C;  2BBK L;  2HKR D;  4FA9 C;  2J55 L;  3PXW C;  3RLM C;  2HXC D;  2J56 L;  3L4O C;  4Y5R C;  4O1Q C;  2AGX D;  2GC4 B;  2GC7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...