2MTAL

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 29
structure length 124
sequence length 125
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2mtaL00
3PXWC 2I0SD 1MG2B 2IAAB 3SXTC 2IUQD 2AGXD 4FA9C 4FANC 2GC4B 4FB1C 3RLMC 4FA5C 2J56L 2HKRD 2Q7QD 2H3XB 2HJBD 3PXSC 3RMZC 2BBKL 1MG3B 4Y5RC 4K3IC 2OJYD 3ORVC 2I0RD 3L4OC 3L4MC 3SWSC 2AGYD 2IUPD 3RN0C 2IURD 4FA1C 1MAEL 2IUVD 4O1QC 2AGWD 2HKMD 2MADL 4FAVC 3RN1C 2I0TD 3C75L 2J55L 1MAFL 1MDAL 2GC7B 4FA4C 2AGLD 2HJ4D 3PXTC 3SLEC 4L3HC 3SVWC 2J57K 2AH0D 4L1QC 2HXCD 2AH1D 2OK4D 4L3GC 2MTAL 3SJLC 2OK6D 2AGZD 2H47B 2OIZD
chains in the Genus database with same CATH superfamily
3PXWC 2I0SD 1MG2B 2IAAB 3SXTC 2IUQD 2AGXD 4FA9C 4FANC 2GC4B 4FB1C 3RLMC 4FA5C 2J56L 2HKRD 2Q7QD 2H3XB 2HJBD 3PXSC 3RMZC 2BBKL 1MG3B 4Y5RC 4K3IC 2OJYD 3ORVC 2I0RD 3L4OC 3L4MC 3SWSC 2AGYD 2IUPD 3RN0C 2IURD 4FA1C 1MAEL 2IUVD 4O1QC 2AGWD 2HKMD 2MADL 4FAVC 3RN1C 2I0TD 3C75L 2J55L 1MAFL 1MDAL 2GC7B 4FA4C 2AGLD 2HJ4D 3PXTC 3SLEC 4L3HC 3SVWC 2J57K 2AH0D 4L1QC 2HXCD 2AH1D 2OK4D 4L3GC 2MTAL 3SJLC 2OK6D 2AGZD 2H47B 2OIZD
chains in the Genus database with same CATH topology
3PXWC 2I0SD 1MG2B 2IAAB 3SXTC 2IUQD 2AGXD 4FA9C 4FANC 2GC4B 4FB1C 3RLMC 4FA5C 2J56L 2HKRD 2Q7QD 2H3XB 2HJBD 3PXSC 3RMZC 2BBKL 1MG3B 4Y5RC 4K3IC 2OJYD 3ORVC 2I0RD 3L4OC 3L4MC 3SWSC 2AGYD 2IUPD 3RN0C 2IURD 4FA1C 1MAEL 2IUVD 4O1QC 2AGWD 2HKMD 2MADL 4FAVC 3RN1C 2I0TD 3C75L 2J55L 1MAFL 1MDAL 2GC7B 4FA4C 2AGLD 2HJ4D 3PXTC 3SLEC 4L3HC 3SVWC 2J57K 2AH0D 4L1QC 2HXCD 2AH1D 2OK4D 4L3GC 2MTAL 3SJLC 2OK6D 2AGZD 2H47B 2OIZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXW C;  2I0S D;  1MG2 B;  2IAA B;  3SXT C;  2IUQ D;  2AGX D;  4FA9 C;  4FAN C;  2GC4 B;  4FB1 C;  3RLM C;  4FA5 C;  2J56 L;  2HKR D;  2Q7Q D;  2H3X B;  2HJB D;  3PXS C;  3RMZ C;  2BBK L;  1MG3 B;  4Y5R C;  4K3I C;  2OJY D;  3ORV C;  2I0R D;  3L4O C;  3L4M C;  3SWS C;  2AGY D;  2IUP D;  3RN0 C;  2IUR D;  4FA1 C;  1MAE L;  2IUV D;  4O1Q C;  2AGW D;  2HKM D;  2MAD L;  4FAV C;  3RN1 C;  2I0T D;  3C75 L;  2J55 L;  1MAF L;  1MDA L;  2GC7 B;  4FA4 C;  2AGL D;  2HJ4 D;  3PXT C;  3SLE C;  4L3H C;  3SVW C;  2J57 K;  2AH0 D;  4L1Q C;  2HXC D;  2AH1 D;  2OK4 D;  4L3G C;  2MTA L;  3SJL C;  2OK6 D;  2AGZ D;  2H47 B;  2OIZ D; 
#chains in the Genus database with same CATH topology
 3PXW C;  2I0S D;  1MG2 B;  2IAA B;  3SXT C;  2IUQ D;  2AGX D;  4FA9 C;  4FAN C;  2GC4 B;  4FB1 C;  3RLM C;  4FA5 C;  2J56 L;  2HKR D;  2Q7Q D;  2H3X B;  2HJB D;  3PXS C;  3RMZ C;  2BBK L;  1MG3 B;  4Y5R C;  4K3I C;  2OJY D;  3ORV C;  2I0R D;  3L4O C;  3L4M C;  3SWS C;  2AGY D;  2IUP D;  3RN0 C;  2IUR D;  4FA1 C;  1MAE L;  2IUV D;  4O1Q C;  2AGW D;  2HKM D;  2MAD L;  4FAV C;  3RN1 C;  2I0T D;  3C75 L;  2J55 L;  1MAF L;  1MDA L;  2GC7 B;  4FA4 C;  2AGL D;  2HJ4 D;  3PXT C;  3SLE C;  4L3H C;  3SVW C;  2J57 K;  2AH0 D;  4L1Q C;  2HXC D;  2AH1 D;  2OK4 D;  4L3G C;  2MTA L;  3SJL C;  2OK6 D;  2AGZ D;  2H47 B;  2OIZ D; 
#chains in the Genus database with same CATH homology
 3PXW C;  2I0S D;  1MG2 B;  2IAA B;  3SXT C;  2IUQ D;  2AGX D;  4FA9 C;  4FAN C;  2GC4 B;  4FB1 C;  3RLM C;  4FA5 C;  2J56 L;  2HKR D;  2Q7Q D;  2H3X B;  2HJB D;  3PXS C;  3RMZ C;  2BBK L;  1MG3 B;  4Y5R C;  4K3I C;  2OJY D;  3ORV C;  2I0R D;  3L4O C;  3L4M C;  3SWS C;  2AGY D;  2IUP D;  3RN0 C;  2IUR D;  4FA1 C;  1MAE L;  2IUV D;  4O1Q C;  2AGW D;  2HKM D;  2MAD L;  4FAV C;  3RN1 C;  2I0T D;  3C75 L;  2J55 L;  1MAF L;  1MDA L;  2GC7 B;  4FA4 C;  2AGL D;  2HJ4 D;  3PXT C;  3SLE C;  4L3H C;  3SVW C;  2J57 K;  2AH0 D;  4L1Q C;  2HXC D;  2AH1 D;  2OK4 D;  4L3G C;  2MTA L;  3SJL C;  2OK6 D;  2AGZ D;  2H47 B;  2OIZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...