2MTAL

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
total genus 29
structure length 124
sequence length 125
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2mtaL00
3L4MC 3ORVC 4L1QC 2IUVD 3SWSC 2J55L 2HJ4D 2AGYD 1MAEL 2OK4D 3PXTC 4L3GC 2HXCD 2OK6D 4L3HC 2AGZD 2AGXD 2BBKL 3PXWC 4K3IC 4FANC 4FB1C 2AH1D 3L4OC 4FA5C 2AH0D 2MTAL 2OJYD 2H3XB 3RLMC 3RN0C 3SXTC 4FAVC 2I0TD 2GC4B 3SJLC 1MDAL 2IURD 1MG3B 3PXSC 2I0RD 4Y5RC 3RN1C 2HJBD 4FA9C 2IUPD 1MG2B 2AGWD 2I0SD 2OIZD 3C75L 3SLEC 4O1QC 1MAFL 2IUQD 2MADL 2HKRD 2Q7QD 2H47B 4FA4C 4FA1C 2GC7B 2J56L 2J57K 2HKMD 2IAAB 3RMZC 3SVWC 2AGLD
chains in the Genus database with same CATH superfamily
3L4MC 3ORVC 4L1QC 2IUVD 3SWSC 2J55L 2HJ4D 2AGYD 1MAEL 2OK4D 3PXTC 4L3GC 2HXCD 2OK6D 4L3HC 2AGZD 2AGXD 2BBKL 3PXWC 4K3IC 4FANC 4FB1C 2AH1D 3L4OC 4FA5C 2AH0D 2MTAL 2OJYD 2H3XB 3RLMC 3RN0C 3SXTC 4FAVC 2I0TD 2GC4B 3SJLC 1MDAL 2IURD 1MG3B 3PXSC 2I0RD 4Y5RC 3RN1C 2HJBD 4FA9C 2IUPD 1MG2B 2AGWD 2I0SD 2OIZD 3C75L 3SLEC 4O1QC 1MAFL 2IUQD 2MADL 2HKRD 2Q7QD 2H47B 4FA4C 4FA1C 2GC7B 2J56L 2J57K 2HKMD 2IAAB 3RMZC 3SVWC 2AGLD
chains in the Genus database with same CATH topology
3L4MC 3ORVC 4L1QC 2IUVD 3SWSC 2J55L 2HJ4D 2AGYD 1MAEL 2OK4D 3PXTC 4L3GC 2HXCD 2OK6D 4L3HC 2AGZD 2AGXD 2BBKL 3PXWC 4K3IC 4FANC 4FB1C 2AH1D 3L4OC 4FA5C 2AH0D 2MTAL 2OJYD 2H3XB 3RLMC 3RN0C 3SXTC 4FAVC 2I0TD 2GC4B 3SJLC 1MDAL 2IURD 1MG3B 3PXSC 2I0RD 4Y5RC 3RN1C 2HJBD 4FA9C 2IUPD 1MG2B 2AGWD 2I0SD 2OIZD 3C75L 3SLEC 4O1QC 1MAFL 2IUQD 2MADL 2HKRD 2Q7QD 2H47B 4FA4C 4FA1C 2GC7B 2J56L 2J57K 2HKMD 2IAAB 3RMZC 3SVWC 2AGLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4M C;  3ORV C;  4L1Q C;  2IUV D;  3SWS C;  2J55 L;  2HJ4 D;  2AGY D;  1MAE L;  2OK4 D;  3PXT C;  4L3G C;  2HXC D;  2OK6 D;  4L3H C;  2AGZ D;  2AGX D;  2BBK L;  3PXW C;  4K3I C;  4FAN C;  4FB1 C;  2AH1 D;  3L4O C;  4FA5 C;  2AH0 D;  2MTA L;  2OJY D;  2H3X B;  3RLM C;  3RN0 C;  3SXT C;  4FAV C;  2I0T D;  2GC4 B;  3SJL C;  1MDA L;  2IUR D;  1MG3 B;  3PXS C;  2I0R D;  4Y5R C;  3RN1 C;  2HJB D;  4FA9 C;  2IUP D;  1MG2 B;  2AGW D;  2I0S D;  2OIZ D;  3C75 L;  3SLE C;  4O1Q C;  1MAF L;  2IUQ D;  2MAD L;  2HKR D;  2Q7Q D;  2H47 B;  4FA4 C;  4FA1 C;  2GC7 B;  2J56 L;  2J57 K;  2HKM D;  2IAA B;  3RMZ C;  3SVW C;  2AGL D; 
#chains in the Genus database with same CATH topology
 3L4M C;  3ORV C;  4L1Q C;  2IUV D;  3SWS C;  2J55 L;  2HJ4 D;  2AGY D;  1MAE L;  2OK4 D;  3PXT C;  4L3G C;  2HXC D;  2OK6 D;  4L3H C;  2AGZ D;  2AGX D;  2BBK L;  3PXW C;  4K3I C;  4FAN C;  4FB1 C;  2AH1 D;  3L4O C;  4FA5 C;  2AH0 D;  2MTA L;  2OJY D;  2H3X B;  3RLM C;  3RN0 C;  3SXT C;  4FAV C;  2I0T D;  2GC4 B;  3SJL C;  1MDA L;  2IUR D;  1MG3 B;  3PXS C;  2I0R D;  4Y5R C;  3RN1 C;  2HJB D;  4FA9 C;  2IUP D;  1MG2 B;  2AGW D;  2I0S D;  2OIZ D;  3C75 L;  3SLE C;  4O1Q C;  1MAF L;  2IUQ D;  2MAD L;  2HKR D;  2Q7Q D;  2H47 B;  4FA4 C;  4FA1 C;  2GC7 B;  2J56 L;  2J57 K;  2HKM D;  2IAA B;  3RMZ C;  3SVW C;  2AGL D; 
#chains in the Genus database with same CATH homology
 3L4M C;  3ORV C;  4L1Q C;  2IUV D;  3SWS C;  2J55 L;  2HJ4 D;  2AGY D;  1MAE L;  2OK4 D;  3PXT C;  4L3G C;  2HXC D;  2OK6 D;  4L3H C;  2AGZ D;  2AGX D;  2BBK L;  3PXW C;  4K3I C;  4FAN C;  4FB1 C;  2AH1 D;  3L4O C;  4FA5 C;  2AH0 D;  2MTA L;  2OJY D;  2H3X B;  3RLM C;  3RN0 C;  3SXT C;  4FAV C;  2I0T D;  2GC4 B;  3SJL C;  1MDA L;  2IUR D;  1MG3 B;  3PXS C;  2I0R D;  4Y5R C;  3RN1 C;  2HJB D;  4FA9 C;  2IUP D;  1MG2 B;  2AGW D;  2I0S D;  2OIZ D;  3C75 L;  3SLE C;  4O1Q C;  1MAF L;  2IUQ D;  2MAD L;  2HKR D;  2Q7Q D;  2H47 B;  4FA4 C;  4FA1 C;  2GC7 B;  2J56 L;  2J57 K;  2HKM D;  2IAA B;  3RMZ C;  3SVW C;  2AGL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...