4K3IC

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug, c2 space group
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Structures of MauG in complex with quinol and quinone MADH.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4k3iC00
3SXTC 4FAVC 1MG2B 2H47B 2BBKL 2GC4B 3ORVC 4L1QC 3SLEC 3SWSC 2AGXD 4Y5RC 2AGYD 2I0RD 3L4OC 3RN0C 2AGLD 2HXCD 2AH0D 1MAEL 4FA5C 4FB1C 4FA1C 3PXWC 3SVWC 2I0TD 2IUQD 2AGZD 2MADL 2HKRD 2H3XB 2HKMD 4FANC 2J55L 2AH1D 2OK4D 1MDAL 2MTAL 2Q7QD 2IAAB 2OJYD 4FA4C 4L3HC 1MG3B 1MAFL 3SJLC 3RN1C 2IURD 2HJBD 2J56L 3C75L 2IUVD 2AGWD 2J57K 3PXSC 2I0SD 3PXTC 2HJ4D 4O1QC 3L4MC 4K3IC 2IUPD 3RLMC 4FA9C 2OK6D 2OIZD 4L3GC 2GC7B 3RMZC
chains in the Genus database with same CATH superfamily
3SXTC 4FAVC 1MG2B 2H47B 2BBKL 2GC4B 3ORVC 4L1QC 3SLEC 3SWSC 2AGXD 4Y5RC 2AGYD 2I0RD 3L4OC 3RN0C 2AGLD 2HXCD 2AH0D 1MAEL 4FA5C 4FB1C 4FA1C 3PXWC 3SVWC 2I0TD 2IUQD 2AGZD 2MADL 2HKRD 2H3XB 2HKMD 4FANC 2J55L 2AH1D 2OK4D 1MDAL 2MTAL 2Q7QD 2IAAB 2OJYD 4FA4C 4L3HC 1MG3B 1MAFL 3SJLC 3RN1C 2IURD 2HJBD 2J56L 3C75L 2IUVD 2AGWD 2J57K 3PXSC 2I0SD 3PXTC 2HJ4D 4O1QC 3L4MC 4K3IC 2IUPD 3RLMC 4FA9C 2OK6D 2OIZD 4L3GC 2GC7B 3RMZC
chains in the Genus database with same CATH topology
3SXTC 4FAVC 1MG2B 2H47B 2BBKL 2GC4B 3ORVC 4L1QC 3SLEC 3SWSC 2AGXD 4Y5RC 2AGYD 2I0RD 3L4OC 3RN0C 2AGLD 2HXCD 2AH0D 1MAEL 4FA5C 4FB1C 4FA1C 3PXWC 3SVWC 2I0TD 2IUQD 2AGZD 2MADL 2HKRD 2H3XB 2HKMD 4FANC 2J55L 2AH1D 2OK4D 1MDAL 2MTAL 2Q7QD 2IAAB 2OJYD 4FA4C 4L3HC 1MG3B 1MAFL 3SJLC 3RN1C 2IURD 2HJBD 2J56L 3C75L 2IUVD 2AGWD 2J57K 3PXSC 2I0SD 3PXTC 2HJ4D 4O1QC 3L4MC 4K3IC 2IUPD 3RLMC 4FA9C 2OK6D 2OIZD 4L3GC 2GC7B 3RMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXT C;  4FAV C;  1MG2 B;  2H47 B;  2BBK L;  2GC4 B;  3ORV C;  4L1Q C;  3SLE C;  3SWS C;  2AGX D;  4Y5R C;  2AGY D;  2I0R D;  3L4O C;  3RN0 C;  2AGL D;  2HXC D;  2AH0 D;  1MAE L;  4FA5 C;  4FB1 C;  4FA1 C;  3PXW C;  3SVW C;  2I0T D;  2IUQ D;  2AGZ D;  2MAD L;  2HKR D;  2H3X B;  2HKM D;  4FAN C;  2J55 L;  2AH1 D;  2OK4 D;  1MDA L;  2MTA L;  2Q7Q D;  2IAA B;  2OJY D;  4FA4 C;  4L3H C;  1MG3 B;  1MAF L;  3SJL C;  3RN1 C;  2IUR D;  2HJB D;  2J56 L;  3C75 L;  2IUV D;  2AGW D;  2J57 K;  3PXS C;  2I0S D;  3PXT C;  2HJ4 D;  4O1Q C;  3L4M C;  4K3I C;  2IUP D;  3RLM C;  4FA9 C;  2OK6 D;  2OIZ D;  4L3G C;  2GC7 B;  3RMZ C; 
#chains in the Genus database with same CATH topology
 3SXT C;  4FAV C;  1MG2 B;  2H47 B;  2BBK L;  2GC4 B;  3ORV C;  4L1Q C;  3SLE C;  3SWS C;  2AGX D;  4Y5R C;  2AGY D;  2I0R D;  3L4O C;  3RN0 C;  2AGL D;  2HXC D;  2AH0 D;  1MAE L;  4FA5 C;  4FB1 C;  4FA1 C;  3PXW C;  3SVW C;  2I0T D;  2IUQ D;  2AGZ D;  2MAD L;  2HKR D;  2H3X B;  2HKM D;  4FAN C;  2J55 L;  2AH1 D;  2OK4 D;  1MDA L;  2MTA L;  2Q7Q D;  2IAA B;  2OJY D;  4FA4 C;  4L3H C;  1MG3 B;  1MAF L;  3SJL C;  3RN1 C;  2IUR D;  2HJB D;  2J56 L;  3C75 L;  2IUV D;  2AGW D;  2J57 K;  3PXS C;  2I0S D;  3PXT C;  2HJ4 D;  4O1Q C;  3L4M C;  4K3I C;  2IUP D;  3RLM C;  4FA9 C;  2OK6 D;  2OIZ D;  4L3G C;  2GC7 B;  3RMZ C; 
#chains in the Genus database with same CATH homology
 3SXT C;  4FAV C;  1MG2 B;  2H47 B;  2BBK L;  2GC4 B;  3ORV C;  4L1Q C;  3SLE C;  3SWS C;  2AGX D;  4Y5R C;  2AGY D;  2I0R D;  3L4O C;  3RN0 C;  2AGL D;  2HXC D;  2AH0 D;  1MAE L;  4FA5 C;  4FB1 C;  4FA1 C;  3PXW C;  3SVW C;  2I0T D;  2IUQ D;  2AGZ D;  2MAD L;  2HKR D;  2H3X B;  2HKM D;  4FAN C;  2J55 L;  2AH1 D;  2OK4 D;  1MDA L;  2MTA L;  2Q7Q D;  2IAA B;  2OJY D;  4FA4 C;  4L3H C;  1MG3 B;  1MAF L;  3SJL C;  3RN1 C;  2IUR D;  2HJB D;  2J56 L;  3C75 L;  2IUV D;  2AGW D;  2J57 K;  3PXS C;  2I0S D;  3PXT C;  2HJ4 D;  4O1Q C;  3L4M C;  4K3I C;  2IUP D;  3RLM C;  4FA9 C;  2OK6 D;  2OIZ D;  4L3G C;  2GC7 B;  3RMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...