2AGXD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. p212121 form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agxD00
4FAVC 2GC7B 3SJLC 3PXTC 2AGLD 3SWSC 2H3XB 2IUPD 4FA1C 2OK6D 4Y5RC 2AH0D 2AGWD 2BBKL 2H47B 1MAFL 1MDAL 3RLMC 2MTAL 2I0RD 2J57K 3PXSC 2HXCD 2AGZD 2HJBD 4L3HC 4FB1C 4K3IC 3RMZC 3L4MC 2OJYD 4FANC 3L4OC 3SVWC 2MADL 3RN1C 2AGXD 4L1QC 3RN0C 2HJ4D 2Q7QD 3SLEC 2J56L 3SXTC 2IUQD 2IUVD 1MAEL 2I0SD 1MG3B 2IURD 3PXWC 2OK4D 4O1QC 1MG2B 2AH1D 2AGYD 2HKMD 2IAAB 4FA5C 4FA9C 3ORVC 4L3GC 4FA4C 2J55L 3C75L 2OIZD 2HKRD 2I0TD 2GC4B
chains in the Genus database with same CATH superfamily
4FAVC 2GC7B 3SJLC 3PXTC 2AGLD 3SWSC 2H3XB 2IUPD 4FA1C 2OK6D 4Y5RC 2AH0D 2AGWD 2BBKL 2H47B 1MAFL 1MDAL 3RLMC 2MTAL 2I0RD 2J57K 3PXSC 2HXCD 2AGZD 2HJBD 4L3HC 4FB1C 4K3IC 3RMZC 3L4MC 2OJYD 4FANC 3L4OC 3SVWC 2MADL 3RN1C 2AGXD 4L1QC 3RN0C 2HJ4D 2Q7QD 3SLEC 2J56L 3SXTC 2IUQD 2IUVD 1MAEL 2I0SD 1MG3B 2IURD 3PXWC 2OK4D 4O1QC 1MG2B 2AH1D 2AGYD 2HKMD 2IAAB 4FA5C 4FA9C 3ORVC 4L3GC 4FA4C 2J55L 3C75L 2OIZD 2HKRD 2I0TD 2GC4B
chains in the Genus database with same CATH topology
4FAVC 2GC7B 3SJLC 3PXTC 2AGLD 3SWSC 2H3XB 2IUPD 4FA1C 2OK6D 4Y5RC 2AH0D 2AGWD 2BBKL 2H47B 1MAFL 1MDAL 3RLMC 2MTAL 2I0RD 2J57K 3PXSC 2HXCD 2AGZD 2HJBD 4L3HC 4FB1C 4K3IC 3RMZC 3L4MC 2OJYD 4FANC 3L4OC 3SVWC 2MADL 3RN1C 2AGXD 4L1QC 3RN0C 2HJ4D 2Q7QD 3SLEC 2J56L 3SXTC 2IUQD 2IUVD 1MAEL 2I0SD 1MG3B 2IURD 3PXWC 2OK4D 4O1QC 1MG2B 2AH1D 2AGYD 2HKMD 2IAAB 4FA5C 4FA9C 3ORVC 4L3GC 4FA4C 2J55L 3C75L 2OIZD 2HKRD 2I0TD 2GC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV C;  2GC7 B;  3SJL C;  3PXT C;  2AGL D;  3SWS C;  2H3X B;  2IUP D;  4FA1 C;  2OK6 D;  4Y5R C;  2AH0 D;  2AGW D;  2BBK L;  2H47 B;  1MAF L;  1MDA L;  3RLM C;  2MTA L;  2I0R D;  2J57 K;  3PXS C;  2HXC D;  2AGZ D;  2HJB D;  4L3H C;  4FB1 C;  4K3I C;  3RMZ C;  3L4M C;  2OJY D;  4FAN C;  3L4O C;  3SVW C;  2MAD L;  3RN1 C;  2AGX D;  4L1Q C;  3RN0 C;  2HJ4 D;  2Q7Q D;  3SLE C;  2J56 L;  3SXT C;  2IUQ D;  2IUV D;  1MAE L;  2I0S D;  1MG3 B;  2IUR D;  3PXW C;  2OK4 D;  4O1Q C;  1MG2 B;  2AH1 D;  2AGY D;  2HKM D;  2IAA B;  4FA5 C;  4FA9 C;  3ORV C;  4L3G C;  4FA4 C;  2J55 L;  3C75 L;  2OIZ D;  2HKR D;  2I0T D;  2GC4 B; 
#chains in the Genus database with same CATH topology
 4FAV C;  2GC7 B;  3SJL C;  3PXT C;  2AGL D;  3SWS C;  2H3X B;  2IUP D;  4FA1 C;  2OK6 D;  4Y5R C;  2AH0 D;  2AGW D;  2BBK L;  2H47 B;  1MAF L;  1MDA L;  3RLM C;  2MTA L;  2I0R D;  2J57 K;  3PXS C;  2HXC D;  2AGZ D;  2HJB D;  4L3H C;  4FB1 C;  4K3I C;  3RMZ C;  3L4M C;  2OJY D;  4FAN C;  3L4O C;  3SVW C;  2MAD L;  3RN1 C;  2AGX D;  4L1Q C;  3RN0 C;  2HJ4 D;  2Q7Q D;  3SLE C;  2J56 L;  3SXT C;  2IUQ D;  2IUV D;  1MAE L;  2I0S D;  1MG3 B;  2IUR D;  3PXW C;  2OK4 D;  4O1Q C;  1MG2 B;  2AH1 D;  2AGY D;  2HKM D;  2IAA B;  4FA5 C;  4FA9 C;  3ORV C;  4L3G C;  4FA4 C;  2J55 L;  3C75 L;  2OIZ D;  2HKR D;  2I0T D;  2GC4 B; 
#chains in the Genus database with same CATH homology
 4FAV C;  2GC7 B;  3SJL C;  3PXT C;  2AGL D;  3SWS C;  2H3X B;  2IUP D;  4FA1 C;  2OK6 D;  4Y5R C;  2AH0 D;  2AGW D;  2BBK L;  2H47 B;  1MAF L;  1MDA L;  3RLM C;  2MTA L;  2I0R D;  2J57 K;  3PXS C;  2HXC D;  2AGZ D;  2HJB D;  4L3H C;  4FB1 C;  4K3I C;  3RMZ C;  3L4M C;  2OJY D;  4FAN C;  3L4O C;  3SVW C;  2MAD L;  3RN1 C;  2AGX D;  4L1Q C;  3RN0 C;  2HJ4 D;  2Q7Q D;  3SLE C;  2J56 L;  3SXT C;  2IUQ D;  2IUV D;  1MAE L;  2I0S D;  1MG3 B;  2IUR D;  3PXW C;  2OK4 D;  4O1Q C;  1MG2 B;  2AH1 D;  2AGY D;  2HKM D;  2IAA B;  4FA5 C;  4FA9 C;  3ORV C;  4L3G C;  4FA4 C;  2J55 L;  3C75 L;  2OIZ D;  2HKR D;  2I0T D;  2GC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...