2AGXD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. p212121 form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agxD00
2AGLD 2H3XB 2I0TD 2HJBD 2AGYD 4L3HC 3RLMC 4FANC 4Y5RC 2HKMD 4FA9C 4FA5C 2I0RD 2GC7B 2HKRD 3RMZC 2HJ4D 2IURD 2IUQD 3L4MC 3RN0C 2H47B 3RN1C 3L4OC 3SJLC 3C75L 4FA1C 1MG3B 3PXSC 4FAVC 2AGXD 2AH0D 2J55L 2GC4B 2J57K 3SWSC 2AH1D 2MTAL 2OK6D 2OK4D 3PXTC 2Q7QD 3SVWC 1MDAL 1MAEL 4L3GC 2J56L 3ORVC 2I0SD 2IUPD 3SLEC 2IUVD 4FA4C 1MAFL 4O1QC 1MG2B 3PXWC 4L1QC 2IAAB 2HXCD 2OIZD 2BBKL 2MADL 4K3IC 4FB1C 2AGZD 2AGWD 3SXTC 2OJYD
chains in the Genus database with same CATH superfamily
2AGLD 2H3XB 2I0TD 2HJBD 2AGYD 4L3HC 3RLMC 4FANC 4Y5RC 2HKMD 4FA9C 4FA5C 2I0RD 2GC7B 2HKRD 3RMZC 2HJ4D 2IURD 2IUQD 3L4MC 3RN0C 2H47B 3RN1C 3L4OC 3SJLC 3C75L 4FA1C 1MG3B 3PXSC 4FAVC 2AGXD 2AH0D 2J55L 2GC4B 2J57K 3SWSC 2AH1D 2MTAL 2OK6D 2OK4D 3PXTC 2Q7QD 3SVWC 1MDAL 1MAEL 4L3GC 2J56L 3ORVC 2I0SD 2IUPD 3SLEC 2IUVD 4FA4C 1MAFL 4O1QC 1MG2B 3PXWC 4L1QC 2IAAB 2HXCD 2OIZD 2BBKL 2MADL 4K3IC 4FB1C 2AGZD 2AGWD 3SXTC 2OJYD
chains in the Genus database with same CATH topology
2AGLD 2H3XB 2I0TD 2HJBD 2AGYD 4L3HC 3RLMC 4FANC 4Y5RC 2HKMD 4FA9C 4FA5C 2I0RD 2GC7B 2HKRD 3RMZC 2HJ4D 2IURD 2IUQD 3L4MC 3RN0C 2H47B 3RN1C 3L4OC 3SJLC 3C75L 4FA1C 1MG3B 3PXSC 4FAVC 2AGXD 2AH0D 2J55L 2GC4B 2J57K 3SWSC 2AH1D 2MTAL 2OK6D 2OK4D 3PXTC 2Q7QD 3SVWC 1MDAL 1MAEL 4L3GC 2J56L 3ORVC 2I0SD 2IUPD 3SLEC 2IUVD 4FA4C 1MAFL 4O1QC 1MG2B 3PXWC 4L1QC 2IAAB 2HXCD 2OIZD 2BBKL 2MADL 4K3IC 4FB1C 2AGZD 2AGWD 3SXTC 2OJYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGL D;  2H3X B;  2I0T D;  2HJB D;  2AGY D;  4L3H C;  3RLM C;  4FAN C;  4Y5R C;  2HKM D;  4FA9 C;  4FA5 C;  2I0R D;  2GC7 B;  2HKR D;  3RMZ C;  2HJ4 D;  2IUR D;  2IUQ D;  3L4M C;  3RN0 C;  2H47 B;  3RN1 C;  3L4O C;  3SJL C;  3C75 L;  4FA1 C;  1MG3 B;  3PXS C;  4FAV C;  2AGX D;  2AH0 D;  2J55 L;  2GC4 B;  2J57 K;  3SWS C;  2AH1 D;  2MTA L;  2OK6 D;  2OK4 D;  3PXT C;  2Q7Q D;  3SVW C;  1MDA L;  1MAE L;  4L3G C;  2J56 L;  3ORV C;  2I0S D;  2IUP D;  3SLE C;  2IUV D;  4FA4 C;  1MAF L;  4O1Q C;  1MG2 B;  3PXW C;  4L1Q C;  2IAA B;  2HXC D;  2OIZ D;  2BBK L;  2MAD L;  4K3I C;  4FB1 C;  2AGZ D;  2AGW D;  3SXT C;  2OJY D; 
#chains in the Genus database with same CATH topology
 2AGL D;  2H3X B;  2I0T D;  2HJB D;  2AGY D;  4L3H C;  3RLM C;  4FAN C;  4Y5R C;  2HKM D;  4FA9 C;  4FA5 C;  2I0R D;  2GC7 B;  2HKR D;  3RMZ C;  2HJ4 D;  2IUR D;  2IUQ D;  3L4M C;  3RN0 C;  2H47 B;  3RN1 C;  3L4O C;  3SJL C;  3C75 L;  4FA1 C;  1MG3 B;  3PXS C;  4FAV C;  2AGX D;  2AH0 D;  2J55 L;  2GC4 B;  2J57 K;  3SWS C;  2AH1 D;  2MTA L;  2OK6 D;  2OK4 D;  3PXT C;  2Q7Q D;  3SVW C;  1MDA L;  1MAE L;  4L3G C;  2J56 L;  3ORV C;  2I0S D;  2IUP D;  3SLE C;  2IUV D;  4FA4 C;  1MAF L;  4O1Q C;  1MG2 B;  3PXW C;  4L1Q C;  2IAA B;  2HXC D;  2OIZ D;  2BBK L;  2MAD L;  4K3I C;  4FB1 C;  2AGZ D;  2AGW D;  3SXT C;  2OJY D; 
#chains in the Genus database with same CATH homology
 2AGL D;  2H3X B;  2I0T D;  2HJB D;  2AGY D;  4L3H C;  3RLM C;  4FAN C;  4Y5R C;  2HKM D;  4FA9 C;  4FA5 C;  2I0R D;  2GC7 B;  2HKR D;  3RMZ C;  2HJ4 D;  2IUR D;  2IUQ D;  3L4M C;  3RN0 C;  2H47 B;  3RN1 C;  3L4O C;  3SJL C;  3C75 L;  4FA1 C;  1MG3 B;  3PXS C;  4FAV C;  2AGX D;  2AH0 D;  2J55 L;  2GC4 B;  2J57 K;  3SWS C;  2AH1 D;  2MTA L;  2OK6 D;  2OK4 D;  3PXT C;  2Q7Q D;  3SVW C;  1MDA L;  1MAE L;  4L3G C;  2J56 L;  3ORV C;  2I0S D;  2IUP D;  3SLE C;  2IUV D;  4FA4 C;  1MAF L;  4O1Q C;  1MG2 B;  3PXW C;  4L1Q C;  2IAA B;  2HXC D;  2OIZ D;  2BBK L;  2MAD L;  4K3I C;  4FB1 C;  2AGZ D;  2AGW D;  3SXT C;  2OJY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...