2AGXD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. p212121 form
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agxD00
3PXTC 2HKRD 3ORVC 2HJ4D 2H47B 4Y5RC 1MG2B 4K3IC 4FAVC 2IUVD 2I0SD 4L3HC 2OK4D 3SLEC 2I0RD 4L1QC 2AGWD 3RN1C 3RN0C 2AH0D 2MADL 2HXCD 2I0TD 2AGXD 2OK6D 2GC7B 2OJYD 2MTAL 1MG3B 4FA5C 1MAEL 4FA4C 3L4MC 2AH1D 3PXSC 3SXTC 4FA9C 2AGYD 2BBKL 2J57K 2AGZD 2HKMD 2IURD 1MDAL 3L4OC 3RMZC 2H3XB 2AGLD 4FA1C 4L3GC 3RLMC 4FANC 2IUQD 2J56L 1MAFL 2IAAB 2OIZD 3SWSC 4O1QC 3C75L 2IUPD 3SJLC 2GC4B 2J55L 3SVWC 4FB1C 2Q7QD 3PXWC 2HJBD
chains in the Genus database with same CATH superfamily
3PXTC 2HKRD 3ORVC 2HJ4D 2H47B 4Y5RC 1MG2B 4K3IC 4FAVC 2IUVD 2I0SD 4L3HC 2OK4D 3SLEC 2I0RD 4L1QC 2AGWD 3RN1C 3RN0C 2AH0D 2MADL 2HXCD 2I0TD 2AGXD 2OK6D 2GC7B 2OJYD 2MTAL 1MG3B 4FA5C 1MAEL 4FA4C 3L4MC 2AH1D 3PXSC 3SXTC 4FA9C 2AGYD 2BBKL 2J57K 2AGZD 2HKMD 2IURD 1MDAL 3L4OC 3RMZC 2H3XB 2AGLD 4FA1C 4L3GC 3RLMC 4FANC 2IUQD 2J56L 1MAFL 2IAAB 2OIZD 3SWSC 4O1QC 3C75L 2IUPD 3SJLC 2GC4B 2J55L 3SVWC 4FB1C 2Q7QD 3PXWC 2HJBD
chains in the Genus database with same CATH topology
3PXTC 2HKRD 3ORVC 2HJ4D 2H47B 4Y5RC 1MG2B 4K3IC 4FAVC 2IUVD 2I0SD 4L3HC 2OK4D 3SLEC 2I0RD 4L1QC 2AGWD 3RN1C 3RN0C 2AH0D 2MADL 2HXCD 2I0TD 2AGXD 2OK6D 2GC7B 2OJYD 2MTAL 1MG3B 4FA5C 1MAEL 4FA4C 3L4MC 2AH1D 3PXSC 3SXTC 4FA9C 2AGYD 2BBKL 2J57K 2AGZD 2HKMD 2IURD 1MDAL 3L4OC 3RMZC 2H3XB 2AGLD 4FA1C 4L3GC 3RLMC 4FANC 2IUQD 2J56L 1MAFL 2IAAB 2OIZD 3SWSC 4O1QC 3C75L 2IUPD 3SJLC 2GC4B 2J55L 3SVWC 4FB1C 2Q7QD 3PXWC 2HJBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXT C;  2HKR D;  3ORV C;  2HJ4 D;  2H47 B;  4Y5R C;  1MG2 B;  4K3I C;  4FAV C;  2IUV D;  2I0S D;  4L3H C;  2OK4 D;  3SLE C;  2I0R D;  4L1Q C;  2AGW D;  3RN1 C;  3RN0 C;  2AH0 D;  2MAD L;  2HXC D;  2I0T D;  2AGX D;  2OK6 D;  2GC7 B;  2OJY D;  2MTA L;  1MG3 B;  4FA5 C;  1MAE L;  4FA4 C;  3L4M C;  2AH1 D;  3PXS C;  3SXT C;  4FA9 C;  2AGY D;  2BBK L;  2J57 K;  2AGZ D;  2HKM D;  2IUR D;  1MDA L;  3L4O C;  3RMZ C;  2H3X B;  2AGL D;  4FA1 C;  4L3G C;  3RLM C;  4FAN C;  2IUQ D;  2J56 L;  1MAF L;  2IAA B;  2OIZ D;  3SWS C;  4O1Q C;  3C75 L;  2IUP D;  3SJL C;  2GC4 B;  2J55 L;  3SVW C;  4FB1 C;  2Q7Q D;  3PXW C;  2HJB D; 
#chains in the Genus database with same CATH topology
 3PXT C;  2HKR D;  3ORV C;  2HJ4 D;  2H47 B;  4Y5R C;  1MG2 B;  4K3I C;  4FAV C;  2IUV D;  2I0S D;  4L3H C;  2OK4 D;  3SLE C;  2I0R D;  4L1Q C;  2AGW D;  3RN1 C;  3RN0 C;  2AH0 D;  2MAD L;  2HXC D;  2I0T D;  2AGX D;  2OK6 D;  2GC7 B;  2OJY D;  2MTA L;  1MG3 B;  4FA5 C;  1MAE L;  4FA4 C;  3L4M C;  2AH1 D;  3PXS C;  3SXT C;  4FA9 C;  2AGY D;  2BBK L;  2J57 K;  2AGZ D;  2HKM D;  2IUR D;  1MDA L;  3L4O C;  3RMZ C;  2H3X B;  2AGL D;  4FA1 C;  4L3G C;  3RLM C;  4FAN C;  2IUQ D;  2J56 L;  1MAF L;  2IAA B;  2OIZ D;  3SWS C;  4O1Q C;  3C75 L;  2IUP D;  3SJL C;  2GC4 B;  2J55 L;  3SVW C;  4FB1 C;  2Q7Q D;  3PXW C;  2HJB D; 
#chains in the Genus database with same CATH homology
 3PXT C;  2HKR D;  3ORV C;  2HJ4 D;  2H47 B;  4Y5R C;  1MG2 B;  4K3I C;  4FAV C;  2IUV D;  2I0S D;  4L3H C;  2OK4 D;  3SLE C;  2I0R D;  4L1Q C;  2AGW D;  3RN1 C;  3RN0 C;  2AH0 D;  2MAD L;  2HXC D;  2I0T D;  2AGX D;  2OK6 D;  2GC7 B;  2OJY D;  2MTA L;  1MG3 B;  4FA5 C;  1MAE L;  4FA4 C;  3L4M C;  2AH1 D;  3PXS C;  3SXT C;  4FA9 C;  2AGY D;  2BBK L;  2J57 K;  2AGZ D;  2HKM D;  2IUR D;  1MDA L;  3L4O C;  3RMZ C;  2H3X B;  2AGL D;  4FA1 C;  4L3G C;  3RLM C;  4FAN C;  2IUQ D;  2J56 L;  1MAF L;  2IAA B;  2OIZ D;  3SWS C;  4O1Q C;  3C75 L;  2IUP D;  3SJL C;  2GC4 B;  2J55 L;  3SVW C;  4FB1 C;  2Q7Q D;  3PXW C;  2HJB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...