2GC4B

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 30
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc4B00
4L3GC 1MAFL 2I0TD 1MAEL 2IURD 3PXWC 2AGWD 2AGZD 2OK4D 4O1QC 3SJLC 2AGLD 3RMZC 3SVWC 3L4OC 2J56L 2AH0D 4FA4C 2AH1D 2MADL 2OK6D 2OIZD 2HKRD 3RLMC 4L1QC 2I0SD 2J55L 3RN0C 3L4MC 4FA5C 1MG2B 2IAAB 2OJYD 4FANC 4FA9C 2HKMD 3PXTC 3SWSC 2I0RD 2IUQD 2J57K 2BBKL 1MG3B 2GC7B 4FA1C 1MDAL 2Q7QD 2H3XB 2AGXD 2HJBD 3RN1C 3SXTC 4FAVC 2H47B 2IUPD 4L3HC 3C75L 4K3IC 2IUVD 2HJ4D 3ORVC 4FB1C 3SLEC 2AGYD 2MTAL 4Y5RC 2HXCD 2GC4B 3PXSC
chains in the Genus database with same CATH superfamily
4L3GC 1MAFL 2I0TD 1MAEL 2IURD 3PXWC 2AGWD 2AGZD 2OK4D 4O1QC 3SJLC 2AGLD 3RMZC 3SVWC 3L4OC 2J56L 2AH0D 4FA4C 2AH1D 2MADL 2OK6D 2OIZD 2HKRD 3RLMC 4L1QC 2I0SD 2J55L 3RN0C 3L4MC 4FA5C 1MG2B 2IAAB 2OJYD 4FANC 4FA9C 2HKMD 3PXTC 3SWSC 2I0RD 2IUQD 2J57K 2BBKL 1MG3B 2GC7B 4FA1C 1MDAL 2Q7QD 2H3XB 2AGXD 2HJBD 3RN1C 3SXTC 4FAVC 2H47B 2IUPD 4L3HC 3C75L 4K3IC 2IUVD 2HJ4D 3ORVC 4FB1C 3SLEC 2AGYD 2MTAL 4Y5RC 2HXCD 2GC4B 3PXSC
chains in the Genus database with same CATH topology
4L3GC 1MAFL 2I0TD 1MAEL 2IURD 3PXWC 2AGWD 2AGZD 2OK4D 4O1QC 3SJLC 2AGLD 3RMZC 3SVWC 3L4OC 2J56L 2AH0D 4FA4C 2AH1D 2MADL 2OK6D 2OIZD 2HKRD 3RLMC 4L1QC 2I0SD 2J55L 3RN0C 3L4MC 4FA5C 1MG2B 2IAAB 2OJYD 4FANC 4FA9C 2HKMD 3PXTC 3SWSC 2I0RD 2IUQD 2J57K 2BBKL 1MG3B 2GC7B 4FA1C 1MDAL 2Q7QD 2H3XB 2AGXD 2HJBD 3RN1C 3SXTC 4FAVC 2H47B 2IUPD 4L3HC 3C75L 4K3IC 2IUVD 2HJ4D 3ORVC 4FB1C 3SLEC 2AGYD 2MTAL 4Y5RC 2HXCD 2GC4B 3PXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3G C;  1MAF L;  2I0T D;  1MAE L;  2IUR D;  3PXW C;  2AGW D;  2AGZ D;  2OK4 D;  4O1Q C;  3SJL C;  2AGL D;  3RMZ C;  3SVW C;  3L4O C;  2J56 L;  2AH0 D;  4FA4 C;  2AH1 D;  2MAD L;  2OK6 D;  2OIZ D;  2HKR D;  3RLM C;  4L1Q C;  2I0S D;  2J55 L;  3RN0 C;  3L4M C;  4FA5 C;  1MG2 B;  2IAA B;  2OJY D;  4FAN C;  4FA9 C;  2HKM D;  3PXT C;  3SWS C;  2I0R D;  2IUQ D;  2J57 K;  2BBK L;  1MG3 B;  2GC7 B;  4FA1 C;  1MDA L;  2Q7Q D;  2H3X B;  2AGX D;  2HJB D;  3RN1 C;  3SXT C;  4FAV C;  2H47 B;  2IUP D;  4L3H C;  3C75 L;  4K3I C;  2IUV D;  2HJ4 D;  3ORV C;  4FB1 C;  3SLE C;  2AGY D;  2MTA L;  4Y5R C;  2HXC D;  2GC4 B;  3PXS C; 
#chains in the Genus database with same CATH topology
 4L3G C;  1MAF L;  2I0T D;  1MAE L;  2IUR D;  3PXW C;  2AGW D;  2AGZ D;  2OK4 D;  4O1Q C;  3SJL C;  2AGL D;  3RMZ C;  3SVW C;  3L4O C;  2J56 L;  2AH0 D;  4FA4 C;  2AH1 D;  2MAD L;  2OK6 D;  2OIZ D;  2HKR D;  3RLM C;  4L1Q C;  2I0S D;  2J55 L;  3RN0 C;  3L4M C;  4FA5 C;  1MG2 B;  2IAA B;  2OJY D;  4FAN C;  4FA9 C;  2HKM D;  3PXT C;  3SWS C;  2I0R D;  2IUQ D;  2J57 K;  2BBK L;  1MG3 B;  2GC7 B;  4FA1 C;  1MDA L;  2Q7Q D;  2H3X B;  2AGX D;  2HJB D;  3RN1 C;  3SXT C;  4FAV C;  2H47 B;  2IUP D;  4L3H C;  3C75 L;  4K3I C;  2IUV D;  2HJ4 D;  3ORV C;  4FB1 C;  3SLE C;  2AGY D;  2MTA L;  4Y5R C;  2HXC D;  2GC4 B;  3PXS C; 
#chains in the Genus database with same CATH homology
 4L3G C;  1MAF L;  2I0T D;  1MAE L;  2IUR D;  3PXW C;  2AGW D;  2AGZ D;  2OK4 D;  4O1Q C;  3SJL C;  2AGL D;  3RMZ C;  3SVW C;  3L4O C;  2J56 L;  2AH0 D;  4FA4 C;  2AH1 D;  2MAD L;  2OK6 D;  2OIZ D;  2HKR D;  3RLM C;  4L1Q C;  2I0S D;  2J55 L;  3RN0 C;  3L4M C;  4FA5 C;  1MG2 B;  2IAA B;  2OJY D;  4FAN C;  4FA9 C;  2HKM D;  3PXT C;  3SWS C;  2I0R D;  2IUQ D;  2J57 K;  2BBK L;  1MG3 B;  2GC7 B;  4FA1 C;  1MDA L;  2Q7Q D;  2H3X B;  2AGX D;  2HJB D;  3RN1 C;  3SXT C;  4FAV C;  2H47 B;  2IUP D;  4L3H C;  3C75 L;  4K3I C;  2IUV D;  2HJ4 D;  3ORV C;  4FB1 C;  3SLE C;  2AGY D;  2MTA L;  4Y5R C;  2HXC D;  2GC4 B;  3PXS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...