2GC4B

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
total genus 30
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc4B00
2HJBD 4L3GC 2AGXD 1MG2B 2GC4B 2MADL 4L3HC 3L4OC 4FA4C 2IUPD 3SWSC 4FA5C 2HKRD 2I0TD 2OIZD 3PXWC 2OK6D 4L1QC 3L4MC 2HKMD 4FA9C 3RN1C 2AGYD 3RMZC 2IURD 1MAEL 2OJYD 3PXSC 4FB1C 2IAAB 2BBKL 3PXTC 4O1QC 3RN0C 4FANC 1MDAL 2AGWD 2H47B 1MAFL 3ORVC 2J57K 2AGLD 3RLMC 4FA1C 3SVWC 2J55L 2GC7B 2HXCD 2IUVD 2MTAL 2AGZD 2J56L 2Q7QD 2AH0D 3C75L 4Y5RC 4K3IC 2I0SD 1MG3B 2AH1D 2H3XB 2OK4D 2HJ4D 3SXTC 3SLEC 4FAVC 2IUQD 2I0RD 3SJLC
chains in the Genus database with same CATH superfamily
2HJBD 4L3GC 2AGXD 1MG2B 2GC4B 2MADL 4L3HC 3L4OC 4FA4C 2IUPD 3SWSC 4FA5C 2HKRD 2I0TD 2OIZD 3PXWC 2OK6D 4L1QC 3L4MC 2HKMD 4FA9C 3RN1C 2AGYD 3RMZC 2IURD 1MAEL 2OJYD 3PXSC 4FB1C 2IAAB 2BBKL 3PXTC 4O1QC 3RN0C 4FANC 1MDAL 2AGWD 2H47B 1MAFL 3ORVC 2J57K 2AGLD 3RLMC 4FA1C 3SVWC 2J55L 2GC7B 2HXCD 2IUVD 2MTAL 2AGZD 2J56L 2Q7QD 2AH0D 3C75L 4Y5RC 4K3IC 2I0SD 1MG3B 2AH1D 2H3XB 2OK4D 2HJ4D 3SXTC 3SLEC 4FAVC 2IUQD 2I0RD 3SJLC
chains in the Genus database with same CATH topology
2HJBD 4L3GC 2AGXD 1MG2B 2GC4B 2MADL 4L3HC 3L4OC 4FA4C 2IUPD 3SWSC 4FA5C 2HKRD 2I0TD 2OIZD 3PXWC 2OK6D 4L1QC 3L4MC 2HKMD 4FA9C 3RN1C 2AGYD 3RMZC 2IURD 1MAEL 2OJYD 3PXSC 4FB1C 2IAAB 2BBKL 3PXTC 4O1QC 3RN0C 4FANC 1MDAL 2AGWD 2H47B 1MAFL 3ORVC 2J57K 2AGLD 3RLMC 4FA1C 3SVWC 2J55L 2GC7B 2HXCD 2IUVD 2MTAL 2AGZD 2J56L 2Q7QD 2AH0D 3C75L 4Y5RC 4K3IC 2I0SD 1MG3B 2AH1D 2H3XB 2OK4D 2HJ4D 3SXTC 3SLEC 4FAVC 2IUQD 2I0RD 3SJLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJB D;  4L3G C;  2AGX D;  1MG2 B;  2GC4 B;  2MAD L;  4L3H C;  3L4O C;  4FA4 C;  2IUP D;  3SWS C;  4FA5 C;  2HKR D;  2I0T D;  2OIZ D;  3PXW C;  2OK6 D;  4L1Q C;  3L4M C;  2HKM D;  4FA9 C;  3RN1 C;  2AGY D;  3RMZ C;  2IUR D;  1MAE L;  2OJY D;  3PXS C;  4FB1 C;  2IAA B;  2BBK L;  3PXT C;  4O1Q C;  3RN0 C;  4FAN C;  1MDA L;  2AGW D;  2H47 B;  1MAF L;  3ORV C;  2J57 K;  2AGL D;  3RLM C;  4FA1 C;  3SVW C;  2J55 L;  2GC7 B;  2HXC D;  2IUV D;  2MTA L;  2AGZ D;  2J56 L;  2Q7Q D;  2AH0 D;  3C75 L;  4Y5R C;  4K3I C;  2I0S D;  1MG3 B;  2AH1 D;  2H3X B;  2OK4 D;  2HJ4 D;  3SXT C;  3SLE C;  4FAV C;  2IUQ D;  2I0R D;  3SJL C; 
#chains in the Genus database with same CATH topology
 2HJB D;  4L3G C;  2AGX D;  1MG2 B;  2GC4 B;  2MAD L;  4L3H C;  3L4O C;  4FA4 C;  2IUP D;  3SWS C;  4FA5 C;  2HKR D;  2I0T D;  2OIZ D;  3PXW C;  2OK6 D;  4L1Q C;  3L4M C;  2HKM D;  4FA9 C;  3RN1 C;  2AGY D;  3RMZ C;  2IUR D;  1MAE L;  2OJY D;  3PXS C;  4FB1 C;  2IAA B;  2BBK L;  3PXT C;  4O1Q C;  3RN0 C;  4FAN C;  1MDA L;  2AGW D;  2H47 B;  1MAF L;  3ORV C;  2J57 K;  2AGL D;  3RLM C;  4FA1 C;  3SVW C;  2J55 L;  2GC7 B;  2HXC D;  2IUV D;  2MTA L;  2AGZ D;  2J56 L;  2Q7Q D;  2AH0 D;  3C75 L;  4Y5R C;  4K3I C;  2I0S D;  1MG3 B;  2AH1 D;  2H3X B;  2OK4 D;  2HJ4 D;  3SXT C;  3SLE C;  4FAV C;  2IUQ D;  2I0R D;  3SJL C; 
#chains in the Genus database with same CATH homology
 2HJB D;  4L3G C;  2AGX D;  1MG2 B;  2GC4 B;  2MAD L;  4L3H C;  3L4O C;  4FA4 C;  2IUP D;  3SWS C;  4FA5 C;  2HKR D;  2I0T D;  2OIZ D;  3PXW C;  2OK6 D;  4L1Q C;  3L4M C;  2HKM D;  4FA9 C;  3RN1 C;  2AGY D;  3RMZ C;  2IUR D;  1MAE L;  2OJY D;  3PXS C;  4FB1 C;  2IAA B;  2BBK L;  3PXT C;  4O1Q C;  3RN0 C;  4FAN C;  1MDA L;  2AGW D;  2H47 B;  1MAF L;  3ORV C;  2J57 K;  2AGL D;  3RLM C;  4FA1 C;  3SVW C;  2J55 L;  2GC7 B;  2HXC D;  2IUV D;  2MTA L;  2AGZ D;  2J56 L;  2Q7Q D;  2AH0 D;  3C75 L;  4Y5R C;  4K3I C;  2I0S D;  1MG3 B;  2AH1 D;  2H3X B;  2OK4 D;  2HJ4 D;  3SXT C;  3SLE C;  4FAV C;  2IUQ D;  2I0R D;  3SJL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...