2GC4B

Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 30
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc4B00
4FA9C 4L3GC 2AH1D 2H3XB 2IUQD 3PXTC 2GC4B 1MG2B 3PXWC 2HJ4D 3ORVC 2OJYD 2AGWD 3RN0C 2HXCD 3RN1C 4FA1C 3RLMC 2BBKL 3SWSC 4Y5RC 2IURD 2H47B 2IAAB 4FANC 2I0TD 2OK4D 4FA4C 4FA5C 3SXTC 2I0RD 3RMZC 2HKRD 1MAEL 4O1QC 3SVWC 2J57K 3PXSC 3L4OC 2J55L 1MG3B 2OK6D 4L1QC 2J56L 3SLEC 1MAFL 2AGLD 2AGZD 2HJBD 3C75L 2IUPD 2AGYD 2OIZD 2MADL 2HKMD 2MTAL 1MDAL 2AGXD 2AH0D 2GC7B 4FAVC 2Q7QD 3L4MC 4L3HC 3SJLC 4K3IC 4FB1C 2IUVD 2I0SD
chains in the Genus database with same CATH superfamily
4FA9C 4L3GC 2AH1D 2H3XB 2IUQD 3PXTC 2GC4B 1MG2B 3PXWC 2HJ4D 3ORVC 2OJYD 2AGWD 3RN0C 2HXCD 3RN1C 4FA1C 3RLMC 2BBKL 3SWSC 4Y5RC 2IURD 2H47B 2IAAB 4FANC 2I0TD 2OK4D 4FA4C 4FA5C 3SXTC 2I0RD 3RMZC 2HKRD 1MAEL 4O1QC 3SVWC 2J57K 3PXSC 3L4OC 2J55L 1MG3B 2OK6D 4L1QC 2J56L 3SLEC 1MAFL 2AGLD 2AGZD 2HJBD 3C75L 2IUPD 2AGYD 2OIZD 2MADL 2HKMD 2MTAL 1MDAL 2AGXD 2AH0D 2GC7B 4FAVC 2Q7QD 3L4MC 4L3HC 3SJLC 4K3IC 4FB1C 2IUVD 2I0SD
chains in the Genus database with same CATH topology
4FA9C 4L3GC 2AH1D 2H3XB 2IUQD 3PXTC 2GC4B 1MG2B 3PXWC 2HJ4D 3ORVC 2OJYD 2AGWD 3RN0C 2HXCD 3RN1C 4FA1C 3RLMC 2BBKL 3SWSC 4Y5RC 2IURD 2H47B 2IAAB 4FANC 2I0TD 2OK4D 4FA4C 4FA5C 3SXTC 2I0RD 3RMZC 2HKRD 1MAEL 4O1QC 3SVWC 2J57K 3PXSC 3L4OC 2J55L 1MG3B 2OK6D 4L1QC 2J56L 3SLEC 1MAFL 2AGLD 2AGZD 2HJBD 3C75L 2IUPD 2AGYD 2OIZD 2MADL 2HKMD 2MTAL 1MDAL 2AGXD 2AH0D 2GC7B 4FAVC 2Q7QD 3L4MC 4L3HC 3SJLC 4K3IC 4FB1C 2IUVD 2I0SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA9 C;  4L3G C;  2AH1 D;  2H3X B;  2IUQ D;  3PXT C;  2GC4 B;  1MG2 B;  3PXW C;  2HJ4 D;  3ORV C;  2OJY D;  2AGW D;  3RN0 C;  2HXC D;  3RN1 C;  4FA1 C;  3RLM C;  2BBK L;  3SWS C;  4Y5R C;  2IUR D;  2H47 B;  2IAA B;  4FAN C;  2I0T D;  2OK4 D;  4FA4 C;  4FA5 C;  3SXT C;  2I0R D;  3RMZ C;  2HKR D;  1MAE L;  4O1Q C;  3SVW C;  2J57 K;  3PXS C;  3L4O C;  2J55 L;  1MG3 B;  2OK6 D;  4L1Q C;  2J56 L;  3SLE C;  1MAF L;  2AGL D;  2AGZ D;  2HJB D;  3C75 L;  2IUP D;  2AGY D;  2OIZ D;  2MAD L;  2HKM D;  2MTA L;  1MDA L;  2AGX D;  2AH0 D;  2GC7 B;  4FAV C;  2Q7Q D;  3L4M C;  4L3H C;  3SJL C;  4K3I C;  4FB1 C;  2IUV D;  2I0S D; 
#chains in the Genus database with same CATH topology
 4FA9 C;  4L3G C;  2AH1 D;  2H3X B;  2IUQ D;  3PXT C;  2GC4 B;  1MG2 B;  3PXW C;  2HJ4 D;  3ORV C;  2OJY D;  2AGW D;  3RN0 C;  2HXC D;  3RN1 C;  4FA1 C;  3RLM C;  2BBK L;  3SWS C;  4Y5R C;  2IUR D;  2H47 B;  2IAA B;  4FAN C;  2I0T D;  2OK4 D;  4FA4 C;  4FA5 C;  3SXT C;  2I0R D;  3RMZ C;  2HKR D;  1MAE L;  4O1Q C;  3SVW C;  2J57 K;  3PXS C;  3L4O C;  2J55 L;  1MG3 B;  2OK6 D;  4L1Q C;  2J56 L;  3SLE C;  1MAF L;  2AGL D;  2AGZ D;  2HJB D;  3C75 L;  2IUP D;  2AGY D;  2OIZ D;  2MAD L;  2HKM D;  2MTA L;  1MDA L;  2AGX D;  2AH0 D;  2GC7 B;  4FAV C;  2Q7Q D;  3L4M C;  4L3H C;  3SJL C;  4K3I C;  4FB1 C;  2IUV D;  2I0S D; 
#chains in the Genus database with same CATH homology
 4FA9 C;  4L3G C;  2AH1 D;  2H3X B;  2IUQ D;  3PXT C;  2GC4 B;  1MG2 B;  3PXW C;  2HJ4 D;  3ORV C;  2OJY D;  2AGW D;  3RN0 C;  2HXC D;  3RN1 C;  4FA1 C;  3RLM C;  2BBK L;  3SWS C;  4Y5R C;  2IUR D;  2H47 B;  2IAA B;  4FAN C;  2I0T D;  2OK4 D;  4FA4 C;  4FA5 C;  3SXT C;  2I0R D;  3RMZ C;  2HKR D;  1MAE L;  4O1Q C;  3SVW C;  2J57 K;  3PXS C;  3L4O C;  2J55 L;  1MG3 B;  2OK6 D;  4L1Q C;  2J56 L;  3SLE C;  1MAF L;  2AGL D;  2AGZ D;  2HJB D;  3C75 L;  2IUP D;  2AGY D;  2OIZ D;  2MAD L;  2HKM D;  2MTA L;  1MDA L;  2AGX D;  2AH0 D;  2GC7 B;  4FAV C;  2Q7Q D;  3L4M C;  4L3H C;  3SJL C;  4K3I C;  4FB1 C;  2IUV D;  2I0S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...