4L3HC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l3hC00
2Q7QD 4FANC 4FA5C 3SJLC 2IUPD 2OJYD 3SLEC 3PXTC 3C75L 2HKMD 2AGWD 2HJBD 4Y5RC 2IURD 2I0SD 2GC4B 3RN1C 3L4OC 1MG3B 3L4MC 4FB1C 2AGXD 3ORVC 2OIZD 2I0TD 4FA9C 3SXTC 3PXWC 1MAEL 3SVWC 2IAAB 2IUQD 2J55L 2J57K 1MAFL 2AH1D 1MDAL 4L1QC 4O1QC 4FA1C 3SWSC 2OK6D 2H47B 2OK4D 4L3GC 3RN0C 3RMZC 2I0RD 2AGYD 2MADL 4FA4C 4FAVC 1MG2B 2BBKL 4L3HC 2J56L 2GC7B 2HKRD 2HJ4D 2HXCD 2AH0D 4K3IC 2IUVD 2AGZD 2AGLD 3RLMC 2H3XB 3PXSC 2MTAL
chains in the Genus database with same CATH superfamily
2Q7QD 4FANC 4FA5C 3SJLC 2IUPD 2OJYD 3SLEC 3PXTC 3C75L 2HKMD 2AGWD 2HJBD 4Y5RC 2IURD 2I0SD 2GC4B 3RN1C 3L4OC 1MG3B 3L4MC 4FB1C 2AGXD 3ORVC 2OIZD 2I0TD 4FA9C 3SXTC 3PXWC 1MAEL 3SVWC 2IAAB 2IUQD 2J55L 2J57K 1MAFL 2AH1D 1MDAL 4L1QC 4O1QC 4FA1C 3SWSC 2OK6D 2H47B 2OK4D 4L3GC 3RN0C 3RMZC 2I0RD 2AGYD 2MADL 4FA4C 4FAVC 1MG2B 2BBKL 4L3HC 2J56L 2GC7B 2HKRD 2HJ4D 2HXCD 2AH0D 4K3IC 2IUVD 2AGZD 2AGLD 3RLMC 2H3XB 3PXSC 2MTAL
chains in the Genus database with same CATH topology
2Q7QD 4FANC 4FA5C 3SJLC 2IUPD 2OJYD 3SLEC 3PXTC 3C75L 2HKMD 2AGWD 2HJBD 4Y5RC 2IURD 2I0SD 2GC4B 3RN1C 3L4OC 1MG3B 3L4MC 4FB1C 2AGXD 3ORVC 2OIZD 2I0TD 4FA9C 3SXTC 3PXWC 1MAEL 3SVWC 2IAAB 2IUQD 2J55L 2J57K 1MAFL 2AH1D 1MDAL 4L1QC 4O1QC 4FA1C 3SWSC 2OK6D 2H47B 2OK4D 4L3GC 3RN0C 3RMZC 2I0RD 2AGYD 2MADL 4FA4C 4FAVC 1MG2B 2BBKL 4L3HC 2J56L 2GC7B 2HKRD 2HJ4D 2HXCD 2AH0D 4K3IC 2IUVD 2AGZD 2AGLD 3RLMC 2H3XB 3PXSC 2MTAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7Q D;  4FAN C;  4FA5 C;  3SJL C;  2IUP D;  2OJY D;  3SLE C;  3PXT C;  3C75 L;  2HKM D;  2AGW D;  2HJB D;  4Y5R C;  2IUR D;  2I0S D;  2GC4 B;  3RN1 C;  3L4O C;  1MG3 B;  3L4M C;  4FB1 C;  2AGX D;  3ORV C;  2OIZ D;  2I0T D;  4FA9 C;  3SXT C;  3PXW C;  1MAE L;  3SVW C;  2IAA B;  2IUQ D;  2J55 L;  2J57 K;  1MAF L;  2AH1 D;  1MDA L;  4L1Q C;  4O1Q C;  4FA1 C;  3SWS C;  2OK6 D;  2H47 B;  2OK4 D;  4L3G C;  3RN0 C;  3RMZ C;  2I0R D;  2AGY D;  2MAD L;  4FA4 C;  4FAV C;  1MG2 B;  2BBK L;  4L3H C;  2J56 L;  2GC7 B;  2HKR D;  2HJ4 D;  2HXC D;  2AH0 D;  4K3I C;  2IUV D;  2AGZ D;  2AGL D;  3RLM C;  2H3X B;  3PXS C;  2MTA L; 
#chains in the Genus database with same CATH topology
 2Q7Q D;  4FAN C;  4FA5 C;  3SJL C;  2IUP D;  2OJY D;  3SLE C;  3PXT C;  3C75 L;  2HKM D;  2AGW D;  2HJB D;  4Y5R C;  2IUR D;  2I0S D;  2GC4 B;  3RN1 C;  3L4O C;  1MG3 B;  3L4M C;  4FB1 C;  2AGX D;  3ORV C;  2OIZ D;  2I0T D;  4FA9 C;  3SXT C;  3PXW C;  1MAE L;  3SVW C;  2IAA B;  2IUQ D;  2J55 L;  2J57 K;  1MAF L;  2AH1 D;  1MDA L;  4L1Q C;  4O1Q C;  4FA1 C;  3SWS C;  2OK6 D;  2H47 B;  2OK4 D;  4L3G C;  3RN0 C;  3RMZ C;  2I0R D;  2AGY D;  2MAD L;  4FA4 C;  4FAV C;  1MG2 B;  2BBK L;  4L3H C;  2J56 L;  2GC7 B;  2HKR D;  2HJ4 D;  2HXC D;  2AH0 D;  4K3I C;  2IUV D;  2AGZ D;  2AGL D;  3RLM C;  2H3X B;  3PXS C;  2MTA L; 
#chains in the Genus database with same CATH homology
 2Q7Q D;  4FAN C;  4FA5 C;  3SJL C;  2IUP D;  2OJY D;  3SLE C;  3PXT C;  3C75 L;  2HKM D;  2AGW D;  2HJB D;  4Y5R C;  2IUR D;  2I0S D;  2GC4 B;  3RN1 C;  3L4O C;  1MG3 B;  3L4M C;  4FB1 C;  2AGX D;  3ORV C;  2OIZ D;  2I0T D;  4FA9 C;  3SXT C;  3PXW C;  1MAE L;  3SVW C;  2IAA B;  2IUQ D;  2J55 L;  2J57 K;  1MAF L;  2AH1 D;  1MDA L;  4L1Q C;  4O1Q C;  4FA1 C;  3SWS C;  2OK6 D;  2H47 B;  2OK4 D;  4L3G C;  3RN0 C;  3RMZ C;  2I0R D;  2AGY D;  2MAD L;  4FA4 C;  4FAV C;  1MG2 B;  2BBK L;  4L3H C;  2J56 L;  2GC7 B;  2HKR D;  2HJ4 D;  2HXC D;  2AH0 D;  4K3I C;  2IUV D;  2AGZ D;  2AGL D;  3RLM C;  2H3X B;  3PXS C;  2MTA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...