4L3HC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l3hC00
1MG2B 2GC4B 2H47B 2I0RD 2OK4D 3SXTC 3PXTC 1MAFL 3SLEC 1MG3B 2HXCD 4L1QC 4FAVC 2OIZD 4FA4C 2HJBD 2Q7QD 4L3HC 4FA5C 3C75L 2AH0D 2HKRD 2J55L 2J57K 2OJYD 2IAAB 4FA1C 2OK6D 2MADL 4FA9C 2J56L 3SVWC 4L3GC 4Y5RC 2HKMD 2AH1D 3SWSC 4K3IC 4FB1C 2AGZD 2I0TD 3RN0C 1MDAL 2H3XB 2IUPD 2GC7B 3SJLC 2MTAL 2IUQD 3RMZC 2AGXD 3PXWC 1MAEL 2AGLD 2I0SD 3L4OC 3RLMC 2IURD 3RN1C 3ORVC 2AGYD 4O1QC 2HJ4D 2BBKL 2AGWD 3PXSC 3L4MC 2IUVD 4FANC
chains in the Genus database with same CATH superfamily
1MG2B 2GC4B 2H47B 2I0RD 2OK4D 3SXTC 3PXTC 1MAFL 3SLEC 1MG3B 2HXCD 4L1QC 4FAVC 2OIZD 4FA4C 2HJBD 2Q7QD 4L3HC 4FA5C 3C75L 2AH0D 2HKRD 2J55L 2J57K 2OJYD 2IAAB 4FA1C 2OK6D 2MADL 4FA9C 2J56L 3SVWC 4L3GC 4Y5RC 2HKMD 2AH1D 3SWSC 4K3IC 4FB1C 2AGZD 2I0TD 3RN0C 1MDAL 2H3XB 2IUPD 2GC7B 3SJLC 2MTAL 2IUQD 3RMZC 2AGXD 3PXWC 1MAEL 2AGLD 2I0SD 3L4OC 3RLMC 2IURD 3RN1C 3ORVC 2AGYD 4O1QC 2HJ4D 2BBKL 2AGWD 3PXSC 3L4MC 2IUVD 4FANC
chains in the Genus database with same CATH topology
1MG2B 2GC4B 2H47B 2I0RD 2OK4D 3SXTC 3PXTC 1MAFL 3SLEC 1MG3B 2HXCD 4L1QC 4FAVC 2OIZD 4FA4C 2HJBD 2Q7QD 4L3HC 4FA5C 3C75L 2AH0D 2HKRD 2J55L 2J57K 2OJYD 2IAAB 4FA1C 2OK6D 2MADL 4FA9C 2J56L 3SVWC 4L3GC 4Y5RC 2HKMD 2AH1D 3SWSC 4K3IC 4FB1C 2AGZD 2I0TD 3RN0C 1MDAL 2H3XB 2IUPD 2GC7B 3SJLC 2MTAL 2IUQD 3RMZC 2AGXD 3PXWC 1MAEL 2AGLD 2I0SD 3L4OC 3RLMC 2IURD 3RN1C 3ORVC 2AGYD 4O1QC 2HJ4D 2BBKL 2AGWD 3PXSC 3L4MC 2IUVD 4FANC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG2 B;  2GC4 B;  2H47 B;  2I0R D;  2OK4 D;  3SXT C;  3PXT C;  1MAF L;  3SLE C;  1MG3 B;  2HXC D;  4L1Q C;  4FAV C;  2OIZ D;  4FA4 C;  2HJB D;  2Q7Q D;  4L3H C;  4FA5 C;  3C75 L;  2AH0 D;  2HKR D;  2J55 L;  2J57 K;  2OJY D;  2IAA B;  4FA1 C;  2OK6 D;  2MAD L;  4FA9 C;  2J56 L;  3SVW C;  4L3G C;  4Y5R C;  2HKM D;  2AH1 D;  3SWS C;  4K3I C;  4FB1 C;  2AGZ D;  2I0T D;  3RN0 C;  1MDA L;  2H3X B;  2IUP D;  2GC7 B;  3SJL C;  2MTA L;  2IUQ D;  3RMZ C;  2AGX D;  3PXW C;  1MAE L;  2AGL D;  2I0S D;  3L4O C;  3RLM C;  2IUR D;  3RN1 C;  3ORV C;  2AGY D;  4O1Q C;  2HJ4 D;  2BBK L;  2AGW D;  3PXS C;  3L4M C;  2IUV D;  4FAN C; 
#chains in the Genus database with same CATH topology
 1MG2 B;  2GC4 B;  2H47 B;  2I0R D;  2OK4 D;  3SXT C;  3PXT C;  1MAF L;  3SLE C;  1MG3 B;  2HXC D;  4L1Q C;  4FAV C;  2OIZ D;  4FA4 C;  2HJB D;  2Q7Q D;  4L3H C;  4FA5 C;  3C75 L;  2AH0 D;  2HKR D;  2J55 L;  2J57 K;  2OJY D;  2IAA B;  4FA1 C;  2OK6 D;  2MAD L;  4FA9 C;  2J56 L;  3SVW C;  4L3G C;  4Y5R C;  2HKM D;  2AH1 D;  3SWS C;  4K3I C;  4FB1 C;  2AGZ D;  2I0T D;  3RN0 C;  1MDA L;  2H3X B;  2IUP D;  2GC7 B;  3SJL C;  2MTA L;  2IUQ D;  3RMZ C;  2AGX D;  3PXW C;  1MAE L;  2AGL D;  2I0S D;  3L4O C;  3RLM C;  2IUR D;  3RN1 C;  3ORV C;  2AGY D;  4O1Q C;  2HJ4 D;  2BBK L;  2AGW D;  3PXS C;  3L4M C;  2IUV D;  4FAN C; 
#chains in the Genus database with same CATH homology
 1MG2 B;  2GC4 B;  2H47 B;  2I0R D;  2OK4 D;  3SXT C;  3PXT C;  1MAF L;  3SLE C;  1MG3 B;  2HXC D;  4L1Q C;  4FAV C;  2OIZ D;  4FA4 C;  2HJB D;  2Q7Q D;  4L3H C;  4FA5 C;  3C75 L;  2AH0 D;  2HKR D;  2J55 L;  2J57 K;  2OJY D;  2IAA B;  4FA1 C;  2OK6 D;  2MAD L;  4FA9 C;  2J56 L;  3SVW C;  4L3G C;  4Y5R C;  2HKM D;  2AH1 D;  3SWS C;  4K3I C;  4FB1 C;  2AGZ D;  2I0T D;  3RN0 C;  1MDA L;  2H3X B;  2IUP D;  2GC7 B;  3SJL C;  2MTA L;  2IUQ D;  3RMZ C;  2AGX D;  3PXW C;  1MAE L;  2AGL D;  2I0S D;  3L4O C;  3RLM C;  2IUR D;  3RN1 C;  3ORV C;  2AGY D;  4O1Q C;  2HJ4 D;  2BBK L;  2AGW D;  3PXS C;  3L4M C;  2IUV D;  4FAN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...