4L3HC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l3hC00
1MG2B 4FANC 2H3XB 3ORVC 3C75L 1MG3B 3SWSC 4Y5RC 4FA4C 2I0SD 2OK4D 3SJLC 4FB1C 3RLMC 4O1QC 4FA1C 2AGZD 4FA9C 2J56L 3PXWC 2J55L 3SLEC 2I0RD 2OIZD 2BBKL 2AGXD 2OJYD 1MAEL 2HJ4D 2IUVD 2OK6D 2MADL 2HKMD 3L4OC 2AH1D 4L1QC 3SXTC 4FAVC 2AH0D 2HKRD 2HJBD 1MDAL 4FA5C 2Q7QD 4L3GC 2AGYD 4K3IC 2IURD 3PXSC 3SVWC 2J57K 2AGLD 2HXCD 3RMZC 3RN0C 2GC7B 2GC4B 2I0TD 2H47B 3PXTC 4L3HC 3RN1C 3L4MC 2AGWD 2IUQD 2MTAL 1MAFL 2IUPD 2IAAB
chains in the Genus database with same CATH superfamily
1MG2B 4FANC 2H3XB 3ORVC 3C75L 1MG3B 3SWSC 4Y5RC 4FA4C 2I0SD 2OK4D 3SJLC 4FB1C 3RLMC 4O1QC 4FA1C 2AGZD 4FA9C 2J56L 3PXWC 2J55L 3SLEC 2I0RD 2OIZD 2BBKL 2AGXD 2OJYD 1MAEL 2HJ4D 2IUVD 2OK6D 2MADL 2HKMD 3L4OC 2AH1D 4L1QC 3SXTC 4FAVC 2AH0D 2HKRD 2HJBD 1MDAL 4FA5C 2Q7QD 4L3GC 2AGYD 4K3IC 2IURD 3PXSC 3SVWC 2J57K 2AGLD 2HXCD 3RMZC 3RN0C 2GC7B 2GC4B 2I0TD 2H47B 3PXTC 4L3HC 3RN1C 3L4MC 2AGWD 2IUQD 2MTAL 1MAFL 2IUPD 2IAAB
chains in the Genus database with same CATH topology
1MG2B 4FANC 2H3XB 3ORVC 3C75L 1MG3B 3SWSC 4Y5RC 4FA4C 2I0SD 2OK4D 3SJLC 4FB1C 3RLMC 4O1QC 4FA1C 2AGZD 4FA9C 2J56L 3PXWC 2J55L 3SLEC 2I0RD 2OIZD 2BBKL 2AGXD 2OJYD 1MAEL 2HJ4D 2IUVD 2OK6D 2MADL 2HKMD 3L4OC 2AH1D 4L1QC 3SXTC 4FAVC 2AH0D 2HKRD 2HJBD 1MDAL 4FA5C 2Q7QD 4L3GC 2AGYD 4K3IC 2IURD 3PXSC 3SVWC 2J57K 2AGLD 2HXCD 3RMZC 3RN0C 2GC7B 2GC4B 2I0TD 2H47B 3PXTC 4L3HC 3RN1C 3L4MC 2AGWD 2IUQD 2MTAL 1MAFL 2IUPD 2IAAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG2 B;  4FAN C;  2H3X B;  3ORV C;  3C75 L;  1MG3 B;  3SWS C;  4Y5R C;  4FA4 C;  2I0S D;  2OK4 D;  3SJL C;  4FB1 C;  3RLM C;  4O1Q C;  4FA1 C;  2AGZ D;  4FA9 C;  2J56 L;  3PXW C;  2J55 L;  3SLE C;  2I0R D;  2OIZ D;  2BBK L;  2AGX D;  2OJY D;  1MAE L;  2HJ4 D;  2IUV D;  2OK6 D;  2MAD L;  2HKM D;  3L4O C;  2AH1 D;  4L1Q C;  3SXT C;  4FAV C;  2AH0 D;  2HKR D;  2HJB D;  1MDA L;  4FA5 C;  2Q7Q D;  4L3G C;  2AGY D;  4K3I C;  2IUR D;  3PXS C;  3SVW C;  2J57 K;  2AGL D;  2HXC D;  3RMZ C;  3RN0 C;  2GC7 B;  2GC4 B;  2I0T D;  2H47 B;  3PXT C;  4L3H C;  3RN1 C;  3L4M C;  2AGW D;  2IUQ D;  2MTA L;  1MAF L;  2IUP D;  2IAA B; 
#chains in the Genus database with same CATH topology
 1MG2 B;  4FAN C;  2H3X B;  3ORV C;  3C75 L;  1MG3 B;  3SWS C;  4Y5R C;  4FA4 C;  2I0S D;  2OK4 D;  3SJL C;  4FB1 C;  3RLM C;  4O1Q C;  4FA1 C;  2AGZ D;  4FA9 C;  2J56 L;  3PXW C;  2J55 L;  3SLE C;  2I0R D;  2OIZ D;  2BBK L;  2AGX D;  2OJY D;  1MAE L;  2HJ4 D;  2IUV D;  2OK6 D;  2MAD L;  2HKM D;  3L4O C;  2AH1 D;  4L1Q C;  3SXT C;  4FAV C;  2AH0 D;  2HKR D;  2HJB D;  1MDA L;  4FA5 C;  2Q7Q D;  4L3G C;  2AGY D;  4K3I C;  2IUR D;  3PXS C;  3SVW C;  2J57 K;  2AGL D;  2HXC D;  3RMZ C;  3RN0 C;  2GC7 B;  2GC4 B;  2I0T D;  2H47 B;  3PXT C;  4L3H C;  3RN1 C;  3L4M C;  2AGW D;  2IUQ D;  2MTA L;  1MAF L;  2IUP D;  2IAA B; 
#chains in the Genus database with same CATH homology
 1MG2 B;  4FAN C;  2H3X B;  3ORV C;  3C75 L;  1MG3 B;  3SWS C;  4Y5R C;  4FA4 C;  2I0S D;  2OK4 D;  3SJL C;  4FB1 C;  3RLM C;  4O1Q C;  4FA1 C;  2AGZ D;  4FA9 C;  2J56 L;  3PXW C;  2J55 L;  3SLE C;  2I0R D;  2OIZ D;  2BBK L;  2AGX D;  2OJY D;  1MAE L;  2HJ4 D;  2IUV D;  2OK6 D;  2MAD L;  2HKM D;  3L4O C;  2AH1 D;  4L1Q C;  3SXT C;  4FAV C;  2AH0 D;  2HKR D;  2HJB D;  1MDA L;  4FA5 C;  2Q7Q D;  4L3G C;  2AGY D;  4K3I C;  2IUR D;  3PXS C;  3SVW C;  2J57 K;  2AGL D;  2HXC D;  3RMZ C;  3RN0 C;  2GC7 B;  2GC4 B;  2I0T D;  2H47 B;  3PXT C;  4L3H C;  3RN1 C;  3L4M C;  2AGW D;  2IUQ D;  2MTA L;  1MAF L;  2IUP D;  2IAA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...