2J56L

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- semiquinone in complex with amicyanin.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j56L00
2AH1D 3ORVC 2OJYD 2HJ4D 4L3HC 2IURD 4FA9C 2OK4D 2IUQD 2MADL 4FA5C 2BBKL 2GC4B 1MDAL 4FANC 3SJLC 2J57K 2HKRD 2HKMD 4L1QC 4K3IC 2I0SD 2GC7B 4Y5RC 2J56L 4FB1C 2IUPD 2IUVD 2I0RD 1MAFL 2AH0D 1MG3B 2AGXD 3RMZC 3SWSC 3L4MC 2Q7QD 3PXSC 2AGZD 3RLMC 2OIZD 4L3GC 4FA4C 2J55L 1MG2B 2AGWD 3C75L 3RN1C 3PXWC 1MAEL 2I0TD 3RN0C 3SLEC 4FA1C 3SXTC 3SVWC 4O1QC 4FAVC 2H3XB 2HXCD 2IAAB 2HJBD 2MTAL 2OK6D 3L4OC 3PXTC 2AGLD 2H47B 2AGYD
chains in the Genus database with same CATH superfamily
2AH1D 3ORVC 2OJYD 2HJ4D 4L3HC 2IURD 4FA9C 2OK4D 2IUQD 2MADL 4FA5C 2BBKL 2GC4B 1MDAL 4FANC 3SJLC 2J57K 2HKRD 2HKMD 4L1QC 4K3IC 2I0SD 2GC7B 4Y5RC 2J56L 4FB1C 2IUPD 2IUVD 2I0RD 1MAFL 2AH0D 1MG3B 2AGXD 3RMZC 3SWSC 3L4MC 2Q7QD 3PXSC 2AGZD 3RLMC 2OIZD 4L3GC 4FA4C 2J55L 1MG2B 2AGWD 3C75L 3RN1C 3PXWC 1MAEL 2I0TD 3RN0C 3SLEC 4FA1C 3SXTC 3SVWC 4O1QC 4FAVC 2H3XB 2HXCD 2IAAB 2HJBD 2MTAL 2OK6D 3L4OC 3PXTC 2AGLD 2H47B 2AGYD
chains in the Genus database with same CATH topology
2AH1D 3ORVC 2OJYD 2HJ4D 4L3HC 2IURD 4FA9C 2OK4D 2IUQD 2MADL 4FA5C 2BBKL 2GC4B 1MDAL 4FANC 3SJLC 2J57K 2HKRD 2HKMD 4L1QC 4K3IC 2I0SD 2GC7B 4Y5RC 2J56L 4FB1C 2IUPD 2IUVD 2I0RD 1MAFL 2AH0D 1MG3B 2AGXD 3RMZC 3SWSC 3L4MC 2Q7QD 3PXSC 2AGZD 3RLMC 2OIZD 4L3GC 4FA4C 2J55L 1MG2B 2AGWD 3C75L 3RN1C 3PXWC 1MAEL 2I0TD 3RN0C 3SLEC 4FA1C 3SXTC 3SVWC 4O1QC 4FAVC 2H3XB 2HXCD 2IAAB 2HJBD 2MTAL 2OK6D 3L4OC 3PXTC 2AGLD 2H47B 2AGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH1 D;  3ORV C;  2OJY D;  2HJ4 D;  4L3H C;  2IUR D;  4FA9 C;  2OK4 D;  2IUQ D;  2MAD L;  4FA5 C;  2BBK L;  2GC4 B;  1MDA L;  4FAN C;  3SJL C;  2J57 K;  2HKR D;  2HKM D;  4L1Q C;  4K3I C;  2I0S D;  2GC7 B;  4Y5R C;  2J56 L;  4FB1 C;  2IUP D;  2IUV D;  2I0R D;  1MAF L;  2AH0 D;  1MG3 B;  2AGX D;  3RMZ C;  3SWS C;  3L4M C;  2Q7Q D;  3PXS C;  2AGZ D;  3RLM C;  2OIZ D;  4L3G C;  4FA4 C;  2J55 L;  1MG2 B;  2AGW D;  3C75 L;  3RN1 C;  3PXW C;  1MAE L;  2I0T D;  3RN0 C;  3SLE C;  4FA1 C;  3SXT C;  3SVW C;  4O1Q C;  4FAV C;  2H3X B;  2HXC D;  2IAA B;  2HJB D;  2MTA L;  2OK6 D;  3L4O C;  3PXT C;  2AGL D;  2H47 B;  2AGY D; 
#chains in the Genus database with same CATH topology
 2AH1 D;  3ORV C;  2OJY D;  2HJ4 D;  4L3H C;  2IUR D;  4FA9 C;  2OK4 D;  2IUQ D;  2MAD L;  4FA5 C;  2BBK L;  2GC4 B;  1MDA L;  4FAN C;  3SJL C;  2J57 K;  2HKR D;  2HKM D;  4L1Q C;  4K3I C;  2I0S D;  2GC7 B;  4Y5R C;  2J56 L;  4FB1 C;  2IUP D;  2IUV D;  2I0R D;  1MAF L;  2AH0 D;  1MG3 B;  2AGX D;  3RMZ C;  3SWS C;  3L4M C;  2Q7Q D;  3PXS C;  2AGZ D;  3RLM C;  2OIZ D;  4L3G C;  4FA4 C;  2J55 L;  1MG2 B;  2AGW D;  3C75 L;  3RN1 C;  3PXW C;  1MAE L;  2I0T D;  3RN0 C;  3SLE C;  4FA1 C;  3SXT C;  3SVW C;  4O1Q C;  4FAV C;  2H3X B;  2HXC D;  2IAA B;  2HJB D;  2MTA L;  2OK6 D;  3L4O C;  3PXT C;  2AGL D;  2H47 B;  2AGY D; 
#chains in the Genus database with same CATH homology
 2AH1 D;  3ORV C;  2OJY D;  2HJ4 D;  4L3H C;  2IUR D;  4FA9 C;  2OK4 D;  2IUQ D;  2MAD L;  4FA5 C;  2BBK L;  2GC4 B;  1MDA L;  4FAN C;  3SJL C;  2J57 K;  2HKR D;  2HKM D;  4L1Q C;  4K3I C;  2I0S D;  2GC7 B;  4Y5R C;  2J56 L;  4FB1 C;  2IUP D;  2IUV D;  2I0R D;  1MAF L;  2AH0 D;  1MG3 B;  2AGX D;  3RMZ C;  3SWS C;  3L4M C;  2Q7Q D;  3PXS C;  2AGZ D;  3RLM C;  2OIZ D;  4L3G C;  4FA4 C;  2J55 L;  1MG2 B;  2AGW D;  3C75 L;  3RN1 C;  3PXW C;  1MAE L;  2I0T D;  3RN0 C;  3SLE C;  4FA1 C;  3SXT C;  3SVW C;  4O1Q C;  4FAV C;  2H3X B;  2HXC D;  2IAA B;  2HJB D;  2MTA L;  2OK6 D;  3L4O C;  3PXT C;  2AGL D;  2H47 B;  2AGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...