2J56L

X-ray reduced paraccocus denitrificans methylamine dehydrogenase n- semiquinone in complex with amicyanin.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMICYANIN
publication title Tracking X-Ray-Derived Redox Changes in Crystals of a Methylamine Dehydrogenase/Amicyanin Complex Using Single-Crystal Uv/Vis Microspectrophotometry.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2j56L00
3PXTC 2AGLD 4FA4C 3ORVC 2MADL 2I0RD 2MTAL 4FB1C 2IAAB 3PXSC 1MG3B 2HKMD 3PXWC 2AGYD 2HKRD 2OIZD 2J55L 2AH0D 3C75L 4FANC 3SWSC 1MAFL 2IURD 3SLEC 4FA9C 2BBKL 2HJBD 3RMZC 1MAEL 4L3HC 1MG2B 3L4MC 2OJYD 2AGXD 2IUQD 3RLMC 2H47B 2GC4B 2H3XB 4FA1C 4L3GC 2IUPD 4O1QC 2OK4D 3SJLC 3SVWC 3L4OC 2IUVD 4FAVC 2HJ4D 4FA5C 2HXCD 3RN0C 1MDAL 2I0TD 4Y5RC 4K3IC 2I0SD 2J56L 2OK6D 2Q7QD 4L1QC 2AGZD 2AGWD 2GC7B 3RN1C 3SXTC 2J57K 2AH1D
chains in the Genus database with same CATH superfamily
3PXTC 2AGLD 4FA4C 3ORVC 2MADL 2I0RD 2MTAL 4FB1C 2IAAB 3PXSC 1MG3B 2HKMD 3PXWC 2AGYD 2HKRD 2OIZD 2J55L 2AH0D 3C75L 4FANC 3SWSC 1MAFL 2IURD 3SLEC 4FA9C 2BBKL 2HJBD 3RMZC 1MAEL 4L3HC 1MG2B 3L4MC 2OJYD 2AGXD 2IUQD 3RLMC 2H47B 2GC4B 2H3XB 4FA1C 4L3GC 2IUPD 4O1QC 2OK4D 3SJLC 3SVWC 3L4OC 2IUVD 4FAVC 2HJ4D 4FA5C 2HXCD 3RN0C 1MDAL 2I0TD 4Y5RC 4K3IC 2I0SD 2J56L 2OK6D 2Q7QD 4L1QC 2AGZD 2AGWD 2GC7B 3RN1C 3SXTC 2J57K 2AH1D
chains in the Genus database with same CATH topology
3PXTC 2AGLD 4FA4C 3ORVC 2MADL 2I0RD 2MTAL 4FB1C 2IAAB 3PXSC 1MG3B 2HKMD 3PXWC 2AGYD 2HKRD 2OIZD 2J55L 2AH0D 3C75L 4FANC 3SWSC 1MAFL 2IURD 3SLEC 4FA9C 2BBKL 2HJBD 3RMZC 1MAEL 4L3HC 1MG2B 3L4MC 2OJYD 2AGXD 2IUQD 3RLMC 2H47B 2GC4B 2H3XB 4FA1C 4L3GC 2IUPD 4O1QC 2OK4D 3SJLC 3SVWC 3L4OC 2IUVD 4FAVC 2HJ4D 4FA5C 2HXCD 3RN0C 1MDAL 2I0TD 4Y5RC 4K3IC 2I0SD 2J56L 2OK6D 2Q7QD 4L1QC 2AGZD 2AGWD 2GC7B 3RN1C 3SXTC 2J57K 2AH1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXT C;  2AGL D;  4FA4 C;  3ORV C;  2MAD L;  2I0R D;  2MTA L;  4FB1 C;  2IAA B;  3PXS C;  1MG3 B;  2HKM D;  3PXW C;  2AGY D;  2HKR D;  2OIZ D;  2J55 L;  2AH0 D;  3C75 L;  4FAN C;  3SWS C;  1MAF L;  2IUR D;  3SLE C;  4FA9 C;  2BBK L;  2HJB D;  3RMZ C;  1MAE L;  4L3H C;  1MG2 B;  3L4M C;  2OJY D;  2AGX D;  2IUQ D;  3RLM C;  2H47 B;  2GC4 B;  2H3X B;  4FA1 C;  4L3G C;  2IUP D;  4O1Q C;  2OK4 D;  3SJL C;  3SVW C;  3L4O C;  2IUV D;  4FAV C;  2HJ4 D;  4FA5 C;  2HXC D;  3RN0 C;  1MDA L;  2I0T D;  4Y5R C;  4K3I C;  2I0S D;  2J56 L;  2OK6 D;  2Q7Q D;  4L1Q C;  2AGZ D;  2AGW D;  2GC7 B;  3RN1 C;  3SXT C;  2J57 K;  2AH1 D; 
#chains in the Genus database with same CATH topology
 3PXT C;  2AGL D;  4FA4 C;  3ORV C;  2MAD L;  2I0R D;  2MTA L;  4FB1 C;  2IAA B;  3PXS C;  1MG3 B;  2HKM D;  3PXW C;  2AGY D;  2HKR D;  2OIZ D;  2J55 L;  2AH0 D;  3C75 L;  4FAN C;  3SWS C;  1MAF L;  2IUR D;  3SLE C;  4FA9 C;  2BBK L;  2HJB D;  3RMZ C;  1MAE L;  4L3H C;  1MG2 B;  3L4M C;  2OJY D;  2AGX D;  2IUQ D;  3RLM C;  2H47 B;  2GC4 B;  2H3X B;  4FA1 C;  4L3G C;  2IUP D;  4O1Q C;  2OK4 D;  3SJL C;  3SVW C;  3L4O C;  2IUV D;  4FAV C;  2HJ4 D;  4FA5 C;  2HXC D;  3RN0 C;  1MDA L;  2I0T D;  4Y5R C;  4K3I C;  2I0S D;  2J56 L;  2OK6 D;  2Q7Q D;  4L1Q C;  2AGZ D;  2AGW D;  2GC7 B;  3RN1 C;  3SXT C;  2J57 K;  2AH1 D; 
#chains in the Genus database with same CATH homology
 3PXT C;  2AGL D;  4FA4 C;  3ORV C;  2MAD L;  2I0R D;  2MTA L;  4FB1 C;  2IAA B;  3PXS C;  1MG3 B;  2HKM D;  3PXW C;  2AGY D;  2HKR D;  2OIZ D;  2J55 L;  2AH0 D;  3C75 L;  4FAN C;  3SWS C;  1MAF L;  2IUR D;  3SLE C;  4FA9 C;  2BBK L;  2HJB D;  3RMZ C;  1MAE L;  4L3H C;  1MG2 B;  3L4M C;  2OJY D;  2AGX D;  2IUQ D;  3RLM C;  2H47 B;  2GC4 B;  2H3X B;  4FA1 C;  4L3G C;  2IUP D;  4O1Q C;  2OK4 D;  3SJL C;  3SVW C;  3L4O C;  2IUV D;  4FAV C;  2HJ4 D;  4FA5 C;  2HXC D;  3RN0 C;  1MDA L;  2I0T D;  4Y5R C;  4K3I C;  2I0S D;  2J56 L;  2OK6 D;  2Q7Q D;  4L1Q C;  2AGZ D;  2AGW D;  2GC7 B;  3RN1 C;  3SXT C;  2J57 K;  2AH1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...