2H3XB

Crystal structure of an electron transfer complex between aromatic amine dehydrogenase and azurin from alcaligenes faecalis (form 3)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
ADHISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2h3xB00
2Q7QD 4L1QC 1MAFL 2HKRD 2IUVD 3RMZC 4FA9C 3SVWC 3PXWC 4O1QC 4Y5RC 4FB1C 2AH0D 3PXSC 3RLMC 2J56L 2HXCD 3L4MC 1MG3B 4FANC 4L3HC 4L3GC 3L4OC 2OK6D 3SWSC 1MG2B 2H47B 4FA5C 2I0TD 2J57K 3RN1C 3PXTC 2I0RD 3SXTC 2AGZD 2HKMD 2HJBD 3ORVC 2OJYD 2AGXD 2HJ4D 2GC4B 3SJLC 2OK4D 4FA4C 2IUQD 2MADL 2AGYD 2BBKL 2I0SD 4FAVC 2AGLD 2J55L 2IURD 1MDAL 2MTAL 2OIZD 2IUPD 3C75L 3SLEC 2AGWD 2GC7B 4FA1C 3RN0C 2H3XB 2IAAB 4K3IC 2AH1D 1MAEL
chains in the Genus database with same CATH superfamily
2Q7QD 4L1QC 1MAFL 2HKRD 2IUVD 3RMZC 4FA9C 3SVWC 3PXWC 4O1QC 4Y5RC 4FB1C 2AH0D 3PXSC 3RLMC 2J56L 2HXCD 3L4MC 1MG3B 4FANC 4L3HC 4L3GC 3L4OC 2OK6D 3SWSC 1MG2B 2H47B 4FA5C 2I0TD 2J57K 3RN1C 3PXTC 2I0RD 3SXTC 2AGZD 2HKMD 2HJBD 3ORVC 2OJYD 2AGXD 2HJ4D 2GC4B 3SJLC 2OK4D 4FA4C 2IUQD 2MADL 2AGYD 2BBKL 2I0SD 4FAVC 2AGLD 2J55L 2IURD 1MDAL 2MTAL 2OIZD 2IUPD 3C75L 3SLEC 2AGWD 2GC7B 4FA1C 3RN0C 2H3XB 2IAAB 4K3IC 2AH1D 1MAEL
chains in the Genus database with same CATH topology
2Q7QD 4L1QC 1MAFL 2HKRD 2IUVD 3RMZC 4FA9C 3SVWC 3PXWC 4O1QC 4Y5RC 4FB1C 2AH0D 3PXSC 3RLMC 2J56L 2HXCD 3L4MC 1MG3B 4FANC 4L3HC 4L3GC 3L4OC 2OK6D 3SWSC 1MG2B 2H47B 4FA5C 2I0TD 2J57K 3RN1C 3PXTC 2I0RD 3SXTC 2AGZD 2HKMD 2HJBD 3ORVC 2OJYD 2AGXD 2HJ4D 2GC4B 3SJLC 2OK4D 4FA4C 2IUQD 2MADL 2AGYD 2BBKL 2I0SD 4FAVC 2AGLD 2J55L 2IURD 1MDAL 2MTAL 2OIZD 2IUPD 3C75L 3SLEC 2AGWD 2GC7B 4FA1C 3RN0C 2H3XB 2IAAB 4K3IC 2AH1D 1MAEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7Q D;  4L1Q C;  1MAF L;  2HKR D;  2IUV D;  3RMZ C;  4FA9 C;  3SVW C;  3PXW C;  4O1Q C;  4Y5R C;  4FB1 C;  2AH0 D;  3PXS C;  3RLM C;  2J56 L;  2HXC D;  3L4M C;  1MG3 B;  4FAN C;  4L3H C;  4L3G C;  3L4O C;  2OK6 D;  3SWS C;  1MG2 B;  2H47 B;  4FA5 C;  2I0T D;  2J57 K;  3RN1 C;  3PXT C;  2I0R D;  3SXT C;  2AGZ D;  2HKM D;  2HJB D;  3ORV C;  2OJY D;  2AGX D;  2HJ4 D;  2GC4 B;  3SJL C;  2OK4 D;  4FA4 C;  2IUQ D;  2MAD L;  2AGY D;  2BBK L;  2I0S D;  4FAV C;  2AGL D;  2J55 L;  2IUR D;  1MDA L;  2MTA L;  2OIZ D;  2IUP D;  3C75 L;  3SLE C;  2AGW D;  2GC7 B;  4FA1 C;  3RN0 C;  2H3X B;  2IAA B;  4K3I C;  2AH1 D;  1MAE L; 
#chains in the Genus database with same CATH topology
 2Q7Q D;  4L1Q C;  1MAF L;  2HKR D;  2IUV D;  3RMZ C;  4FA9 C;  3SVW C;  3PXW C;  4O1Q C;  4Y5R C;  4FB1 C;  2AH0 D;  3PXS C;  3RLM C;  2J56 L;  2HXC D;  3L4M C;  1MG3 B;  4FAN C;  4L3H C;  4L3G C;  3L4O C;  2OK6 D;  3SWS C;  1MG2 B;  2H47 B;  4FA5 C;  2I0T D;  2J57 K;  3RN1 C;  3PXT C;  2I0R D;  3SXT C;  2AGZ D;  2HKM D;  2HJB D;  3ORV C;  2OJY D;  2AGX D;  2HJ4 D;  2GC4 B;  3SJL C;  2OK4 D;  4FA4 C;  2IUQ D;  2MAD L;  2AGY D;  2BBK L;  2I0S D;  4FAV C;  2AGL D;  2J55 L;  2IUR D;  1MDA L;  2MTA L;  2OIZ D;  2IUP D;  3C75 L;  3SLE C;  2AGW D;  2GC7 B;  4FA1 C;  3RN0 C;  2H3X B;  2IAA B;  4K3I C;  2AH1 D;  1MAE L; 
#chains in the Genus database with same CATH homology
 2Q7Q D;  4L1Q C;  1MAF L;  2HKR D;  2IUV D;  3RMZ C;  4FA9 C;  3SVW C;  3PXW C;  4O1Q C;  4Y5R C;  4FB1 C;  2AH0 D;  3PXS C;  3RLM C;  2J56 L;  2HXC D;  3L4M C;  1MG3 B;  4FAN C;  4L3H C;  4L3G C;  3L4O C;  2OK6 D;  3SWS C;  1MG2 B;  2H47 B;  4FA5 C;  2I0T D;  2J57 K;  3RN1 C;  3PXT C;  2I0R D;  3SXT C;  2AGZ D;  2HKM D;  2HJB D;  3ORV C;  2OJY D;  2AGX D;  2HJ4 D;  2GC4 B;  3SJL C;  2OK4 D;  4FA4 C;  2IUQ D;  2MAD L;  2AGY D;  2BBK L;  2I0S D;  4FAV C;  2AGL D;  2J55 L;  2IUR D;  1MDA L;  2MTA L;  2OIZ D;  2IUP D;  3C75 L;  3SLE C;  2AGW D;  2GC7 B;  4FA1 C;  3RN0 C;  2H3X B;  2IAA B;  4K3I C;  2AH1 D;  1MAE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...