2H3XB

Crystal structure of an electron transfer complex between aromatic amine dehydrogenase and azurin from alcaligenes faecalis (form 3)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
b'ADHISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2h3xB00
2H3XB 2HJBD 2OIZD 1MG3B 4L3GC 2BBKL 2IURD 3PXWC 3RLMC 2AGLD 2AH0D 2OJYD 4L3HC 3RMZC 4K3IC 2I0RD 3RN0C 3RN1C 2MTAL 3L4OC 2H47B 3PXSC 2AGXD 3SLEC 2IAAB 4FAVC 2HXCD 2IUPD 2MADL 2J55L 4FA9C 2I0SD 2AGZD 2OK6D 2GC4B 4Y5RC 1MG2B 2IUVD 2HKMD 3L4MC 3SVWC 3C75L 1MAFL 2HKRD 2J57K 3SJLC 2AH1D 2J56L 4FA5C 2AGYD 2GC7B 2OK4D 2IUQD 3SXTC 4FA1C 4FB1C 3PXTC 3ORVC 4FANC 4L1QC 1MAEL 3SWSC 4O1QC 4FA4C 2HJ4D 2I0TD 2Q7QD 2AGWD 1MDAL
chains in the Genus database with same CATH superfamily
2H3XB 2HJBD 2OIZD 1MG3B 4L3GC 2BBKL 2IURD 3PXWC 3RLMC 2AGLD 2AH0D 2OJYD 4L3HC 3RMZC 4K3IC 2I0RD 3RN0C 3RN1C 2MTAL 3L4OC 2H47B 3PXSC 2AGXD 3SLEC 2IAAB 4FAVC 2HXCD 2IUPD 2MADL 2J55L 4FA9C 2I0SD 2AGZD 2OK6D 2GC4B 4Y5RC 1MG2B 2IUVD 2HKMD 3L4MC 3SVWC 3C75L 1MAFL 2HKRD 2J57K 3SJLC 2AH1D 2J56L 4FA5C 2AGYD 2GC7B 2OK4D 2IUQD 3SXTC 4FA1C 4FB1C 3PXTC 3ORVC 4FANC 4L1QC 1MAEL 3SWSC 4O1QC 4FA4C 2HJ4D 2I0TD 2Q7QD 2AGWD 1MDAL
chains in the Genus database with same CATH topology
2H3XB 2HJBD 2OIZD 1MG3B 4L3GC 2BBKL 2IURD 3PXWC 3RLMC 2AGLD 2AH0D 2OJYD 4L3HC 3RMZC 4K3IC 2I0RD 3RN0C 3RN1C 2MTAL 3L4OC 2H47B 3PXSC 2AGXD 3SLEC 2IAAB 4FAVC 2HXCD 2IUPD 2MADL 2J55L 4FA9C 2I0SD 2AGZD 2OK6D 2GC4B 4Y5RC 1MG2B 2IUVD 2HKMD 3L4MC 3SVWC 3C75L 1MAFL 2HKRD 2J57K 3SJLC 2AH1D 2J56L 4FA5C 2AGYD 2GC7B 2OK4D 2IUQD 3SXTC 4FA1C 4FB1C 3PXTC 3ORVC 4FANC 4L1QC 1MAEL 3SWSC 4O1QC 4FA4C 2HJ4D 2I0TD 2Q7QD 2AGWD 1MDAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3X B;  2HJB D;  2OIZ D;  1MG3 B;  4L3G C;  2BBK L;  2IUR D;  3PXW C;  3RLM C;  2AGL D;  2AH0 D;  2OJY D;  4L3H C;  3RMZ C;  4K3I C;  2I0R D;  3RN0 C;  3RN1 C;  2MTA L;  3L4O C;  2H47 B;  3PXS C;  2AGX D;  3SLE C;  2IAA B;  4FAV C;  2HXC D;  2IUP D;  2MAD L;  2J55 L;  4FA9 C;  2I0S D;  2AGZ D;  2OK6 D;  2GC4 B;  4Y5R C;  1MG2 B;  2IUV D;  2HKM D;  3L4M C;  3SVW C;  3C75 L;  1MAF L;  2HKR D;  2J57 K;  3SJL C;  2AH1 D;  2J56 L;  4FA5 C;  2AGY D;  2GC7 B;  2OK4 D;  2IUQ D;  3SXT C;  4FA1 C;  4FB1 C;  3PXT C;  3ORV C;  4FAN C;  4L1Q C;  1MAE L;  3SWS C;  4O1Q C;  4FA4 C;  2HJ4 D;  2I0T D;  2Q7Q D;  2AGW D;  1MDA L; 
#chains in the Genus database with same CATH topology
 2H3X B;  2HJB D;  2OIZ D;  1MG3 B;  4L3G C;  2BBK L;  2IUR D;  3PXW C;  3RLM C;  2AGL D;  2AH0 D;  2OJY D;  4L3H C;  3RMZ C;  4K3I C;  2I0R D;  3RN0 C;  3RN1 C;  2MTA L;  3L4O C;  2H47 B;  3PXS C;  2AGX D;  3SLE C;  2IAA B;  4FAV C;  2HXC D;  2IUP D;  2MAD L;  2J55 L;  4FA9 C;  2I0S D;  2AGZ D;  2OK6 D;  2GC4 B;  4Y5R C;  1MG2 B;  2IUV D;  2HKM D;  3L4M C;  3SVW C;  3C75 L;  1MAF L;  2HKR D;  2J57 K;  3SJL C;  2AH1 D;  2J56 L;  4FA5 C;  2AGY D;  2GC7 B;  2OK4 D;  2IUQ D;  3SXT C;  4FA1 C;  4FB1 C;  3PXT C;  3ORV C;  4FAN C;  4L1Q C;  1MAE L;  3SWS C;  4O1Q C;  4FA4 C;  2HJ4 D;  2I0T D;  2Q7Q D;  2AGW D;  1MDA L; 
#chains in the Genus database with same CATH homology
 2H3X B;  2HJB D;  2OIZ D;  1MG3 B;  4L3G C;  2BBK L;  2IUR D;  3PXW C;  3RLM C;  2AGL D;  2AH0 D;  2OJY D;  4L3H C;  3RMZ C;  4K3I C;  2I0R D;  3RN0 C;  3RN1 C;  2MTA L;  3L4O C;  2H47 B;  3PXS C;  2AGX D;  3SLE C;  2IAA B;  4FAV C;  2HXC D;  2IUP D;  2MAD L;  2J55 L;  4FA9 C;  2I0S D;  2AGZ D;  2OK6 D;  2GC4 B;  4Y5R C;  1MG2 B;  2IUV D;  2HKM D;  3L4M C;  3SVW C;  3C75 L;  1MAF L;  2HKR D;  2J57 K;  3SJL C;  2AH1 D;  2J56 L;  4FA5 C;  2AGY D;  2GC7 B;  2OK4 D;  2IUQ D;  3SXT C;  4FA1 C;  4FB1 C;  3PXT C;  3ORV C;  4FAN C;  4L1Q C;  1MAE L;  3SWS C;  4O1Q C;  4FA4 C;  2HJ4 D;  2I0T D;  2Q7Q D;  2AGW D;  1MDA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...