The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
110
|
structure length |
109
|
Chain Sequence |
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Oxidoreductase
|
publication title |
New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb |
molecule keywords |
Aromatic amine dehydrogenase, small subunit
|
total genus |
28
|
structure length |
109
|
sequence length |
110
|
chains with identical sequence |
H
|
ec nomenclature |
ec
1.4.9.2: Aralkylamine dehydrogenase (azurin). |
pdb deposition date | 2007-01-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
D | PF02975 | Me-amine-dh_L | Methylamine dehydrogenase, L chain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Electron Transport Ethylamine Dehydrogenase | Methylamine/Aralkylamine dehydrogenase light chain |
#chains in the Genus database with same CATH superfamily 3RN1 C; 1MG2 B; 3SXT C; 3L4O C; 4FA4 C; 2Q7Q D; 2IUQ D; 3C75 L; 3SWS C; 3RMZ C; 2AGW D; 2AH0 D; 3PXS C; 2AH1 D; 2I0T D; 2AGX D; 3L4M C; 4FA5 C; 2HKM D; 2AGY D; 2IAA B; 2IUP D; 2OIZ D; 2BBK L; 4K3I C; 4L3G C; 3RN0 C; 2H3X B; 4FAN C; 2AGL D; 4FB1 C; 2J56 L; 4Y5R C; 3SVW C; 4L1Q C; 4FAV C; 2HJB D; 3PXT C; 3RLM C; 2HKR D; 2HJ4 D; 2J55 L; 3SLE C; 2IUV D; 2OK4 D; 2I0S D; 2AGZ D; 2OK6 D; 1MDA L; 1MG3 B; 2OJY D; 3ORV C; 2MTA L; 3PXW C; 4L3H C; 4O1Q C; 2GC7 B; 2HXC D; 2J57 K; 2IUR D; 2GC4 B; 2I0R D; 4FA9 C; 2H47 B; 1MAE L; 3SJL C; 2MAD L; 1MAF L; 4FA1 C; #chains in the Genus database with same CATH topology 3RN1 C; 1MG2 B; 3SXT C; 3L4O C; 4FA4 C; 2Q7Q D; 2IUQ D; 3C75 L; 3SWS C; 3RMZ C; 2AGW D; 2AH0 D; 3PXS C; 2AH1 D; 2I0T D; 2AGX D; 3L4M C; 4FA5 C; 2HKM D; 2AGY D; 2IAA B; 2IUP D; 2OIZ D; 2BBK L; 4K3I C; 4L3G C; 3RN0 C; 2H3X B; 4FAN C; 2AGL D; 4FB1 C; 2J56 L; 4Y5R C; 3SVW C; 4L1Q C; 4FAV C; 2HJB D; 3PXT C; 3RLM C; 2HKR D; 2HJ4 D; 2J55 L; 3SLE C; 2IUV D; 2OK4 D; 2I0S D; 2AGZ D; 2OK6 D; 1MDA L; 1MG3 B; 2OJY D; 3ORV C; 2MTA L; 3PXW C; 4L3H C; 4O1Q C; 2GC7 B; 2HXC D; 2J57 K; 2IUR D; 2GC4 B; 2I0R D; 4FA9 C; 2H47 B; 1MAE L; 3SJL C; 2MAD L; 1MAF L; 4FA1 C; #chains in the Genus database with same CATH homology 3RN1 C; 1MG2 B; 3SXT C; 3L4O C; 4FA4 C; 2Q7Q D; 2IUQ D; 3C75 L; 3SWS C; 3RMZ C; 2AGW D; 2AH0 D; 3PXS C; 2AH1 D; 2I0T D; 2AGX D; 3L4M C; 4FA5 C; 2HKM D; 2AGY D; 2IAA B; 2IUP D; 2OIZ D; 2BBK L; 4K3I C; 4L3G C; 3RN0 C; 2H3X B; 4FAN C; 2AGL D; 4FB1 C; 2J56 L; 4Y5R C; 3SVW C; 4L1Q C; 4FAV C; 2HJB D; 3PXT C; 3RLM C; 2HKR D; 2HJ4 D; 2J55 L; 3SLE C; 2IUV D; 2OK4 D; 2I0S D; 2AGZ D; 2OK6 D; 1MDA L; 1MG3 B; 2OJY D; 3ORV C; 2MTA L; 3PXW C; 4L3H C; 4O1Q C; 2GC7 B; 2HXC D; 2J57 K; 2IUR D; 2GC4 B; 2I0R D; 4FA9 C; 2H47 B; 1MAE L; 3SJL C; 2MAD L; 1MAF L; 4FA1 C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...