2OK6D

Crystal structure of aromatic amine dehydrogenase ttq-formamide adduct oxidized with ferricyanide.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
109
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ok6D00
4FA1C 2IUPD 2IUVD 2Q7QD 3L4OC 3PXTC 2MADL 4Y5RC 1MG3B 2HKRD 2BBKL 4FAVC 1MG2B 2GC7B 2I0RD 3ORVC 3RN0C 3SWSC 3PXWC 2HXCD 2I0TD 2H3XB 1MDAL 2IAAB 2I0SD 2AGWD 3SJLC 2AH0D 4O1QC 3SVWC 2J56L 2GC4B 1MAFL 2OIZD 3PXSC 2MTAL 4K3IC 4FA4C 2HKMD 4FA5C 4L3HC 2AGZD 4FB1C 2IURD 3C75L 2AGXD 3RMZC 2J55L 2OJYD 2AGYD 1MAEL 2AGLD 2H47B 2HJBD 2HJ4D 2IUQD 2OK6D 3L4MC 4FANC 4L1QC 3RLMC 3RN1C 3SXTC 2J57K 4FA9C 4L3GC 3SLEC 2AH1D 2OK4D
chains in the Genus database with same CATH superfamily
4FA1C 2IUPD 2IUVD 2Q7QD 3L4OC 3PXTC 2MADL 4Y5RC 1MG3B 2HKRD 2BBKL 4FAVC 1MG2B 2GC7B 2I0RD 3ORVC 3RN0C 3SWSC 3PXWC 2HXCD 2I0TD 2H3XB 1MDAL 2IAAB 2I0SD 2AGWD 3SJLC 2AH0D 4O1QC 3SVWC 2J56L 2GC4B 1MAFL 2OIZD 3PXSC 2MTAL 4K3IC 4FA4C 2HKMD 4FA5C 4L3HC 2AGZD 4FB1C 2IURD 3C75L 2AGXD 3RMZC 2J55L 2OJYD 2AGYD 1MAEL 2AGLD 2H47B 2HJBD 2HJ4D 2IUQD 2OK6D 3L4MC 4FANC 4L1QC 3RLMC 3RN1C 3SXTC 2J57K 4FA9C 4L3GC 3SLEC 2AH1D 2OK4D
chains in the Genus database with same CATH topology
4FA1C 2IUPD 2IUVD 2Q7QD 3L4OC 3PXTC 2MADL 4Y5RC 1MG3B 2HKRD 2BBKL 4FAVC 1MG2B 2GC7B 2I0RD 3ORVC 3RN0C 3SWSC 3PXWC 2HXCD 2I0TD 2H3XB 1MDAL 2IAAB 2I0SD 2AGWD 3SJLC 2AH0D 4O1QC 3SVWC 2J56L 2GC4B 1MAFL 2OIZD 3PXSC 2MTAL 4K3IC 4FA4C 2HKMD 4FA5C 4L3HC 2AGZD 4FB1C 2IURD 3C75L 2AGXD 3RMZC 2J55L 2OJYD 2AGYD 1MAEL 2AGLD 2H47B 2HJBD 2HJ4D 2IUQD 2OK6D 3L4MC 4FANC 4L1QC 3RLMC 3RN1C 3SXTC 2J57K 4FA9C 4L3GC 3SLEC 2AH1D 2OK4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA1 C;  2IUP D;  2IUV D;  2Q7Q D;  3L4O C;  3PXT C;  2MAD L;  4Y5R C;  1MG3 B;  2HKR D;  2BBK L;  4FAV C;  1MG2 B;  2GC7 B;  2I0R D;  3ORV C;  3RN0 C;  3SWS C;  3PXW C;  2HXC D;  2I0T D;  2H3X B;  1MDA L;  2IAA B;  2I0S D;  2AGW D;  3SJL C;  2AH0 D;  4O1Q C;  3SVW C;  2J56 L;  2GC4 B;  1MAF L;  2OIZ D;  3PXS C;  2MTA L;  4K3I C;  4FA4 C;  2HKM D;  4FA5 C;  4L3H C;  2AGZ D;  4FB1 C;  2IUR D;  3C75 L;  2AGX D;  3RMZ C;  2J55 L;  2OJY D;  2AGY D;  1MAE L;  2AGL D;  2H47 B;  2HJB D;  2HJ4 D;  2IUQ D;  2OK6 D;  3L4M C;  4FAN C;  4L1Q C;  3RLM C;  3RN1 C;  3SXT C;  2J57 K;  4FA9 C;  4L3G C;  3SLE C;  2AH1 D;  2OK4 D; 
#chains in the Genus database with same CATH topology
 4FA1 C;  2IUP D;  2IUV D;  2Q7Q D;  3L4O C;  3PXT C;  2MAD L;  4Y5R C;  1MG3 B;  2HKR D;  2BBK L;  4FAV C;  1MG2 B;  2GC7 B;  2I0R D;  3ORV C;  3RN0 C;  3SWS C;  3PXW C;  2HXC D;  2I0T D;  2H3X B;  1MDA L;  2IAA B;  2I0S D;  2AGW D;  3SJL C;  2AH0 D;  4O1Q C;  3SVW C;  2J56 L;  2GC4 B;  1MAF L;  2OIZ D;  3PXS C;  2MTA L;  4K3I C;  4FA4 C;  2HKM D;  4FA5 C;  4L3H C;  2AGZ D;  4FB1 C;  2IUR D;  3C75 L;  2AGX D;  3RMZ C;  2J55 L;  2OJY D;  2AGY D;  1MAE L;  2AGL D;  2H47 B;  2HJB D;  2HJ4 D;  2IUQ D;  2OK6 D;  3L4M C;  4FAN C;  4L1Q C;  3RLM C;  3RN1 C;  3SXT C;  2J57 K;  4FA9 C;  4L3G C;  3SLE C;  2AH1 D;  2OK4 D; 
#chains in the Genus database with same CATH homology
 4FA1 C;  2IUP D;  2IUV D;  2Q7Q D;  3L4O C;  3PXT C;  2MAD L;  4Y5R C;  1MG3 B;  2HKR D;  2BBK L;  4FAV C;  1MG2 B;  2GC7 B;  2I0R D;  3ORV C;  3RN0 C;  3SWS C;  3PXW C;  2HXC D;  2I0T D;  2H3X B;  1MDA L;  2IAA B;  2I0S D;  2AGW D;  3SJL C;  2AH0 D;  4O1Q C;  3SVW C;  2J56 L;  2GC4 B;  1MAF L;  2OIZ D;  3PXS C;  2MTA L;  4K3I C;  4FA4 C;  2HKM D;  4FA5 C;  4L3H C;  2AGZ D;  4FB1 C;  2IUR D;  3C75 L;  2AGX D;  3RMZ C;  2J55 L;  2OJY D;  2AGY D;  1MAE L;  2AGL D;  2H47 B;  2HJB D;  2HJ4 D;  2IUQ D;  2OK6 D;  3L4M C;  4FAN C;  4L1Q C;  3RLM C;  3RN1 C;  3SXT C;  2J57 K;  4FA9 C;  4L3G C;  3SLE C;  2AH1 D;  2OK4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...