2GC7B

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
molecule tags Oxidoreductase, electron transport
total genus 29
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc7B00
2J56L 2HKMD 2IUVD 3RN1C 2AGLD 2OIZD 2J55L 3ORVC 2I0SD 2AGWD 2H47B 2HJBD 2IUPD 2Q7QD 3PXSC 3RN0C 4K3IC 4FA9C 2J57K 1MG2B 2OJYD 2I0RD 2OK4D 1MAFL 3L4MC 3PXWC 3RLMC 2GC4B 4FA5C 3L4OC 3PXTC 2MTAL 2AGYD 2IUQD 2I0TD 4Y5RC 2HKRD 2AGXD 4O1QC 2MADL 4FA4C 2GC7B 4FA1C 4L1QC 3SJLC 2AGZD 1MAEL 3SLEC 3C75L 3SVWC 4L3GC 2AH0D 1MG3B 2H3XB 1MDAL 2AH1D 2IAAB 2HXCD 4FB1C 4L3HC 3RMZC 4FAVC 3SWSC 2BBKL 2OK6D 4FANC 2HJ4D 2IURD 3SXTC
chains in the Genus database with same CATH superfamily
2J56L 2HKMD 2IUVD 3RN1C 2AGLD 2OIZD 2J55L 3ORVC 2I0SD 2AGWD 2H47B 2HJBD 2IUPD 2Q7QD 3PXSC 3RN0C 4K3IC 4FA9C 2J57K 1MG2B 2OJYD 2I0RD 2OK4D 1MAFL 3L4MC 3PXWC 3RLMC 2GC4B 4FA5C 3L4OC 3PXTC 2MTAL 2AGYD 2IUQD 2I0TD 4Y5RC 2HKRD 2AGXD 4O1QC 2MADL 4FA4C 2GC7B 4FA1C 4L1QC 3SJLC 2AGZD 1MAEL 3SLEC 3C75L 3SVWC 4L3GC 2AH0D 1MG3B 2H3XB 1MDAL 2AH1D 2IAAB 2HXCD 4FB1C 4L3HC 3RMZC 4FAVC 3SWSC 2BBKL 2OK6D 4FANC 2HJ4D 2IURD 3SXTC
chains in the Genus database with same CATH topology
2J56L 2HKMD 2IUVD 3RN1C 2AGLD 2OIZD 2J55L 3ORVC 2I0SD 2AGWD 2H47B 2HJBD 2IUPD 2Q7QD 3PXSC 3RN0C 4K3IC 4FA9C 2J57K 1MG2B 2OJYD 2I0RD 2OK4D 1MAFL 3L4MC 3PXWC 3RLMC 2GC4B 4FA5C 3L4OC 3PXTC 2MTAL 2AGYD 2IUQD 2I0TD 4Y5RC 2HKRD 2AGXD 4O1QC 2MADL 4FA4C 2GC7B 4FA1C 4L1QC 3SJLC 2AGZD 1MAEL 3SLEC 3C75L 3SVWC 4L3GC 2AH0D 1MG3B 2H3XB 1MDAL 2AH1D 2IAAB 2HXCD 4FB1C 4L3HC 3RMZC 4FAVC 3SWSC 2BBKL 2OK6D 4FANC 2HJ4D 2IURD 3SXTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J56 L;  2HKM D;  2IUV D;  3RN1 C;  2AGL D;  2OIZ D;  2J55 L;  3ORV C;  2I0S D;  2AGW D;  2H47 B;  2HJB D;  2IUP D;  2Q7Q D;  3PXS C;  3RN0 C;  4K3I C;  4FA9 C;  2J57 K;  1MG2 B;  2OJY D;  2I0R D;  2OK4 D;  1MAF L;  3L4M C;  3PXW C;  3RLM C;  2GC4 B;  4FA5 C;  3L4O C;  3PXT C;  2MTA L;  2AGY D;  2IUQ D;  2I0T D;  4Y5R C;  2HKR D;  2AGX D;  4O1Q C;  2MAD L;  4FA4 C;  2GC7 B;  4FA1 C;  4L1Q C;  3SJL C;  2AGZ D;  1MAE L;  3SLE C;  3C75 L;  3SVW C;  4L3G C;  2AH0 D;  1MG3 B;  2H3X B;  1MDA L;  2AH1 D;  2IAA B;  2HXC D;  4FB1 C;  4L3H C;  3RMZ C;  4FAV C;  3SWS C;  2BBK L;  2OK6 D;  4FAN C;  2HJ4 D;  2IUR D;  3SXT C; 
#chains in the Genus database with same CATH topology
 2J56 L;  2HKM D;  2IUV D;  3RN1 C;  2AGL D;  2OIZ D;  2J55 L;  3ORV C;  2I0S D;  2AGW D;  2H47 B;  2HJB D;  2IUP D;  2Q7Q D;  3PXS C;  3RN0 C;  4K3I C;  4FA9 C;  2J57 K;  1MG2 B;  2OJY D;  2I0R D;  2OK4 D;  1MAF L;  3L4M C;  3PXW C;  3RLM C;  2GC4 B;  4FA5 C;  3L4O C;  3PXT C;  2MTA L;  2AGY D;  2IUQ D;  2I0T D;  4Y5R C;  2HKR D;  2AGX D;  4O1Q C;  2MAD L;  4FA4 C;  2GC7 B;  4FA1 C;  4L1Q C;  3SJL C;  2AGZ D;  1MAE L;  3SLE C;  3C75 L;  3SVW C;  4L3G C;  2AH0 D;  1MG3 B;  2H3X B;  1MDA L;  2AH1 D;  2IAA B;  2HXC D;  4FB1 C;  4L3H C;  3RMZ C;  4FAV C;  3SWS C;  2BBK L;  2OK6 D;  4FAN C;  2HJ4 D;  2IUR D;  3SXT C; 
#chains in the Genus database with same CATH homology
 2J56 L;  2HKM D;  2IUV D;  3RN1 C;  2AGL D;  2OIZ D;  2J55 L;  3ORV C;  2I0S D;  2AGW D;  2H47 B;  2HJB D;  2IUP D;  2Q7Q D;  3PXS C;  3RN0 C;  4K3I C;  4FA9 C;  2J57 K;  1MG2 B;  2OJY D;  2I0R D;  2OK4 D;  1MAF L;  3L4M C;  3PXW C;  3RLM C;  2GC4 B;  4FA5 C;  3L4O C;  3PXT C;  2MTA L;  2AGY D;  2IUQ D;  2I0T D;  4Y5R C;  2HKR D;  2AGX D;  4O1Q C;  2MAD L;  4FA4 C;  2GC7 B;  4FA1 C;  4L1Q C;  3SJL C;  2AGZ D;  1MAE L;  3SLE C;  3C75 L;  3SVW C;  4L3G C;  2AH0 D;  1MG3 B;  2H3X B;  1MDA L;  2AH1 D;  2IAA B;  2HXC D;  4FB1 C;  4L3H C;  3RMZ C;  4FAV C;  3SWS C;  2BBK L;  2OK6 D;  4FAN C;  2HJ4 D;  2IUR D;  3SXT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...