2GC7B

Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Methylamine dehydrogenase heavy chain
publication title Structral comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 A resolution.
rcsb
total genus 29
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2gc7B00
1MDAL 3L4MC 2J56L 2AH1D 2OIZD 3PXSC 1MG2B 4O1QC 4FA5C 2HJBD 3SLEC 1MAEL 2HKRD 3SJLC 1MG3B 2HJ4D 2GC4B 2I0TD 2IAAB 3RN1C 4FANC 2MTAL 3RMZC 2HKMD 3RN0C 2AGWD 2IUQD 4FA1C 2BBKL 4Y5RC 2HXCD 3SVWC 4K3IC 2I0RD 2AGZD 3PXTC 2J55L 4FB1C 4FA4C 2AGXD 2H47B 3C75L 2OK6D 2I0SD 2J57K 3L4OC 1MAFL 4FA9C 2Q7QD 2IUPD 2GC7B 3ORVC 3SWSC 2IURD 4L3HC 3SXTC 2IUVD 4FAVC 2AGLD 2AH0D 2H3XB 3PXWC 2AGYD 2MADL 2OK4D 4L1QC 3RLMC 2OJYD 4L3GC
chains in the Genus database with same CATH superfamily
1MDAL 3L4MC 2J56L 2AH1D 2OIZD 3PXSC 1MG2B 4O1QC 4FA5C 2HJBD 3SLEC 1MAEL 2HKRD 3SJLC 1MG3B 2HJ4D 2GC4B 2I0TD 2IAAB 3RN1C 4FANC 2MTAL 3RMZC 2HKMD 3RN0C 2AGWD 2IUQD 4FA1C 2BBKL 4Y5RC 2HXCD 3SVWC 4K3IC 2I0RD 2AGZD 3PXTC 2J55L 4FB1C 4FA4C 2AGXD 2H47B 3C75L 2OK6D 2I0SD 2J57K 3L4OC 1MAFL 4FA9C 2Q7QD 2IUPD 2GC7B 3ORVC 3SWSC 2IURD 4L3HC 3SXTC 2IUVD 4FAVC 2AGLD 2AH0D 2H3XB 3PXWC 2AGYD 2MADL 2OK4D 4L1QC 3RLMC 2OJYD 4L3GC
chains in the Genus database with same CATH topology
1MDAL 3L4MC 2J56L 2AH1D 2OIZD 3PXSC 1MG2B 4O1QC 4FA5C 2HJBD 3SLEC 1MAEL 2HKRD 3SJLC 1MG3B 2HJ4D 2GC4B 2I0TD 2IAAB 3RN1C 4FANC 2MTAL 3RMZC 2HKMD 3RN0C 2AGWD 2IUQD 4FA1C 2BBKL 4Y5RC 2HXCD 3SVWC 4K3IC 2I0RD 2AGZD 3PXTC 2J55L 4FB1C 4FA4C 2AGXD 2H47B 3C75L 2OK6D 2I0SD 2J57K 3L4OC 1MAFL 4FA9C 2Q7QD 2IUPD 2GC7B 3ORVC 3SWSC 2IURD 4L3HC 3SXTC 2IUVD 4FAVC 2AGLD 2AH0D 2H3XB 3PXWC 2AGYD 2MADL 2OK4D 4L1QC 3RLMC 2OJYD 4L3GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDA L;  3L4M C;  2J56 L;  2AH1 D;  2OIZ D;  3PXS C;  1MG2 B;  4O1Q C;  4FA5 C;  2HJB D;  3SLE C;  1MAE L;  2HKR D;  3SJL C;  1MG3 B;  2HJ4 D;  2GC4 B;  2I0T D;  2IAA B;  3RN1 C;  4FAN C;  2MTA L;  3RMZ C;  2HKM D;  3RN0 C;  2AGW D;  2IUQ D;  4FA1 C;  2BBK L;  4Y5R C;  2HXC D;  3SVW C;  4K3I C;  2I0R D;  2AGZ D;  3PXT C;  2J55 L;  4FB1 C;  4FA4 C;  2AGX D;  2H47 B;  3C75 L;  2OK6 D;  2I0S D;  2J57 K;  3L4O C;  1MAF L;  4FA9 C;  2Q7Q D;  2IUP D;  2GC7 B;  3ORV C;  3SWS C;  2IUR D;  4L3H C;  3SXT C;  2IUV D;  4FAV C;  2AGL D;  2AH0 D;  2H3X B;  3PXW C;  2AGY D;  2MAD L;  2OK4 D;  4L1Q C;  3RLM C;  2OJY D;  4L3G C; 
#chains in the Genus database with same CATH topology
 1MDA L;  3L4M C;  2J56 L;  2AH1 D;  2OIZ D;  3PXS C;  1MG2 B;  4O1Q C;  4FA5 C;  2HJB D;  3SLE C;  1MAE L;  2HKR D;  3SJL C;  1MG3 B;  2HJ4 D;  2GC4 B;  2I0T D;  2IAA B;  3RN1 C;  4FAN C;  2MTA L;  3RMZ C;  2HKM D;  3RN0 C;  2AGW D;  2IUQ D;  4FA1 C;  2BBK L;  4Y5R C;  2HXC D;  3SVW C;  4K3I C;  2I0R D;  2AGZ D;  3PXT C;  2J55 L;  4FB1 C;  4FA4 C;  2AGX D;  2H47 B;  3C75 L;  2OK6 D;  2I0S D;  2J57 K;  3L4O C;  1MAF L;  4FA9 C;  2Q7Q D;  2IUP D;  2GC7 B;  3ORV C;  3SWS C;  2IUR D;  4L3H C;  3SXT C;  2IUV D;  4FAV C;  2AGL D;  2AH0 D;  2H3X B;  3PXW C;  2AGY D;  2MAD L;  2OK4 D;  4L1Q C;  3RLM C;  2OJY D;  4L3G C; 
#chains in the Genus database with same CATH homology
 1MDA L;  3L4M C;  2J56 L;  2AH1 D;  2OIZ D;  3PXS C;  1MG2 B;  4O1Q C;  4FA5 C;  2HJB D;  3SLE C;  1MAE L;  2HKR D;  3SJL C;  1MG3 B;  2HJ4 D;  2GC4 B;  2I0T D;  2IAA B;  3RN1 C;  4FAN C;  2MTA L;  3RMZ C;  2HKM D;  3RN0 C;  2AGW D;  2IUQ D;  4FA1 C;  2BBK L;  4Y5R C;  2HXC D;  3SVW C;  4K3I C;  2I0R D;  2AGZ D;  3PXT C;  2J55 L;  4FB1 C;  4FA4 C;  2AGX D;  2H47 B;  3C75 L;  2OK6 D;  2I0S D;  2J57 K;  3L4O C;  1MAF L;  4FA9 C;  2Q7Q D;  2IUP D;  2GC7 B;  3ORV C;  3SWS C;  2IUR D;  4L3H C;  3SXT C;  2IUV D;  4FAV C;  2AGL D;  2AH0 D;  2H3X B;  3PXW C;  2AGY D;  2MAD L;  2OK4 D;  4L1Q C;  3RLM C;  2OJY D;  4L3G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...