3PXTC

Crystal structure of ferrous co adduct of maug in complex with pre-methylamine dehydrogenase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxtC00
2AGYD 3PXSC 2I0RD 1MDAL 2IUVD 2J57K 3RMZC 4FANC 2H47B 2GC4B 2OIZD 2H3XB 2AGXD 1MG3B 2BBKL 2IAAB 3SXTC 4FB1C 2OJYD 3SWSC 3PXTC 4FAVC 3L4MC 2HJBD 4L3GC 3SVWC 4O1QC 2J55L 2I0TD 4L1QC 1MG2B 2AH1D 3SJLC 4FA5C 2HKRD 2GC7B 3C75L 3L4OC 1MAEL 4K3IC 3RLMC 2J56L 2AGZD 4L3HC 2IUPD 3RN0C 3SLEC 4FA4C 2AGLD 2MADL 2MTAL 2AH0D 2AGWD 1MAFL 4FA1C 2I0SD 2HJ4D 2IUQD 2HKMD 3ORVC 2IURD 4FA9C 2OK4D 2HXCD 3PXWC 3RN1C 2OK6D 4Y5RC 2Q7QD
chains in the Genus database with same CATH superfamily
2AGYD 3PXSC 2I0RD 1MDAL 2IUVD 2J57K 3RMZC 4FANC 2H47B 2GC4B 2OIZD 2H3XB 2AGXD 1MG3B 2BBKL 2IAAB 3SXTC 4FB1C 2OJYD 3SWSC 3PXTC 4FAVC 3L4MC 2HJBD 4L3GC 3SVWC 4O1QC 2J55L 2I0TD 4L1QC 1MG2B 2AH1D 3SJLC 4FA5C 2HKRD 2GC7B 3C75L 3L4OC 1MAEL 4K3IC 3RLMC 2J56L 2AGZD 4L3HC 2IUPD 3RN0C 3SLEC 4FA4C 2AGLD 2MADL 2MTAL 2AH0D 2AGWD 1MAFL 4FA1C 2I0SD 2HJ4D 2IUQD 2HKMD 3ORVC 2IURD 4FA9C 2OK4D 2HXCD 3PXWC 3RN1C 2OK6D 4Y5RC 2Q7QD
chains in the Genus database with same CATH topology
2AGYD 3PXSC 2I0RD 1MDAL 2IUVD 2J57K 3RMZC 4FANC 2H47B 2GC4B 2OIZD 2H3XB 2AGXD 1MG3B 2BBKL 2IAAB 3SXTC 4FB1C 2OJYD 3SWSC 3PXTC 4FAVC 3L4MC 2HJBD 4L3GC 3SVWC 4O1QC 2J55L 2I0TD 4L1QC 1MG2B 2AH1D 3SJLC 4FA5C 2HKRD 2GC7B 3C75L 3L4OC 1MAEL 4K3IC 3RLMC 2J56L 2AGZD 4L3HC 2IUPD 3RN0C 3SLEC 4FA4C 2AGLD 2MADL 2MTAL 2AH0D 2AGWD 1MAFL 4FA1C 2I0SD 2HJ4D 2IUQD 2HKMD 3ORVC 2IURD 4FA9C 2OK4D 2HXCD 3PXWC 3RN1C 2OK6D 4Y5RC 2Q7QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGY D;  3PXS C;  2I0R D;  1MDA L;  2IUV D;  2J57 K;  3RMZ C;  4FAN C;  2H47 B;  2GC4 B;  2OIZ D;  2H3X B;  2AGX D;  1MG3 B;  2BBK L;  2IAA B;  3SXT C;  4FB1 C;  2OJY D;  3SWS C;  3PXT C;  4FAV C;  3L4M C;  2HJB D;  4L3G C;  3SVW C;  4O1Q C;  2J55 L;  2I0T D;  4L1Q C;  1MG2 B;  2AH1 D;  3SJL C;  4FA5 C;  2HKR D;  2GC7 B;  3C75 L;  3L4O C;  1MAE L;  4K3I C;  3RLM C;  2J56 L;  2AGZ D;  4L3H C;  2IUP D;  3RN0 C;  3SLE C;  4FA4 C;  2AGL D;  2MAD L;  2MTA L;  2AH0 D;  2AGW D;  1MAF L;  4FA1 C;  2I0S D;  2HJ4 D;  2IUQ D;  2HKM D;  3ORV C;  2IUR D;  4FA9 C;  2OK4 D;  2HXC D;  3PXW C;  3RN1 C;  2OK6 D;  4Y5R C;  2Q7Q D; 
#chains in the Genus database with same CATH topology
 2AGY D;  3PXS C;  2I0R D;  1MDA L;  2IUV D;  2J57 K;  3RMZ C;  4FAN C;  2H47 B;  2GC4 B;  2OIZ D;  2H3X B;  2AGX D;  1MG3 B;  2BBK L;  2IAA B;  3SXT C;  4FB1 C;  2OJY D;  3SWS C;  3PXT C;  4FAV C;  3L4M C;  2HJB D;  4L3G C;  3SVW C;  4O1Q C;  2J55 L;  2I0T D;  4L1Q C;  1MG2 B;  2AH1 D;  3SJL C;  4FA5 C;  2HKR D;  2GC7 B;  3C75 L;  3L4O C;  1MAE L;  4K3I C;  3RLM C;  2J56 L;  2AGZ D;  4L3H C;  2IUP D;  3RN0 C;  3SLE C;  4FA4 C;  2AGL D;  2MAD L;  2MTA L;  2AH0 D;  2AGW D;  1MAF L;  4FA1 C;  2I0S D;  2HJ4 D;  2IUQ D;  2HKM D;  3ORV C;  2IUR D;  4FA9 C;  2OK4 D;  2HXC D;  3PXW C;  3RN1 C;  2OK6 D;  4Y5R C;  2Q7Q D; 
#chains in the Genus database with same CATH homology
 2AGY D;  3PXS C;  2I0R D;  1MDA L;  2IUV D;  2J57 K;  3RMZ C;  4FAN C;  2H47 B;  2GC4 B;  2OIZ D;  2H3X B;  2AGX D;  1MG3 B;  2BBK L;  2IAA B;  3SXT C;  4FB1 C;  2OJY D;  3SWS C;  3PXT C;  4FAV C;  3L4M C;  2HJB D;  4L3G C;  3SVW C;  4O1Q C;  2J55 L;  2I0T D;  4L1Q C;  1MG2 B;  2AH1 D;  3SJL C;  4FA5 C;  2HKR D;  2GC7 B;  3C75 L;  3L4O C;  1MAE L;  4K3I C;  3RLM C;  2J56 L;  2AGZ D;  4L3H C;  2IUP D;  3RN0 C;  3SLE C;  4FA4 C;  2AGL D;  2MAD L;  2MTA L;  2AH0 D;  2AGW D;  1MAF L;  4FA1 C;  2I0S D;  2HJ4 D;  2IUQ D;  2HKM D;  3ORV C;  2IUR D;  4FA9 C;  2OK4 D;  2HXC D;  3PXW C;  3RN1 C;  2OK6 D;  4Y5R C;  2Q7Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...