3PXTC

Crystal structure of ferrous co adduct of maug in complex with pre-methylamine dehydrogenase
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Crystal Structures of CO and NO Adducts of MauG in Complex with Pre-Methylamine Dehydrogenase: Implications for the Mechanism of Dioxygen Activation.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 3pxtC00
2I0TD 2OJYD 3PXSC 4L1QC 2IAAB 4FAVC 3SLEC 3RLMC 3SJLC 2HKMD 3SWSC 2I0RD 3C75L 2GC7B 2IURD 2J57K 2GC4B 4Y5RC 2AGLD 4FA1C 3L4OC 3SXTC 1MDAL 2HJ4D 4O1QC 2HJBD 4L3HC 3RN1C 2IUPD 2AH0D 2H3XB 2Q7QD 4L3GC 2OIZD 3PXWC 2BBKL 2HXCD 2IUQD 2AGZD 2J56L 1MG2B 1MAEL 2OK4D 4K3IC 4FANC 3SVWC 4FA4C 2AGWD 1MAFL 1MG3B 2AGYD 2IUVD 3RN0C 3RMZC 4FA9C 4FB1C 2H47B 2J55L 2MTAL 3L4MC 3ORVC 2AH1D 2MADL 4FA5C 2OK6D 2I0SD 2HKRD 3PXTC 2AGXD
chains in the Genus database with same CATH superfamily
2I0TD 2OJYD 3PXSC 4L1QC 2IAAB 4FAVC 3SLEC 3RLMC 3SJLC 2HKMD 3SWSC 2I0RD 3C75L 2GC7B 2IURD 2J57K 2GC4B 4Y5RC 2AGLD 4FA1C 3L4OC 3SXTC 1MDAL 2HJ4D 4O1QC 2HJBD 4L3HC 3RN1C 2IUPD 2AH0D 2H3XB 2Q7QD 4L3GC 2OIZD 3PXWC 2BBKL 2HXCD 2IUQD 2AGZD 2J56L 1MG2B 1MAEL 2OK4D 4K3IC 4FANC 3SVWC 4FA4C 2AGWD 1MAFL 1MG3B 2AGYD 2IUVD 3RN0C 3RMZC 4FA9C 4FB1C 2H47B 2J55L 2MTAL 3L4MC 3ORVC 2AH1D 2MADL 4FA5C 2OK6D 2I0SD 2HKRD 3PXTC 2AGXD
chains in the Genus database with same CATH topology
2I0TD 2OJYD 3PXSC 4L1QC 2IAAB 4FAVC 3SLEC 3RLMC 3SJLC 2HKMD 3SWSC 2I0RD 3C75L 2GC7B 2IURD 2J57K 2GC4B 4Y5RC 2AGLD 4FA1C 3L4OC 3SXTC 1MDAL 2HJ4D 4O1QC 2HJBD 4L3HC 3RN1C 2IUPD 2AH0D 2H3XB 2Q7QD 4L3GC 2OIZD 3PXWC 2BBKL 2HXCD 2IUQD 2AGZD 2J56L 1MG2B 1MAEL 2OK4D 4K3IC 4FANC 3SVWC 4FA4C 2AGWD 1MAFL 1MG3B 2AGYD 2IUVD 3RN0C 3RMZC 4FA9C 4FB1C 2H47B 2J55L 2MTAL 3L4MC 3ORVC 2AH1D 2MADL 4FA5C 2OK6D 2I0SD 2HKRD 3PXTC 2AGXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0T D;  2OJY D;  3PXS C;  4L1Q C;  2IAA B;  4FAV C;  3SLE C;  3RLM C;  3SJL C;  2HKM D;  3SWS C;  2I0R D;  3C75 L;  2GC7 B;  2IUR D;  2J57 K;  2GC4 B;  4Y5R C;  2AGL D;  4FA1 C;  3L4O C;  3SXT C;  1MDA L;  2HJ4 D;  4O1Q C;  2HJB D;  4L3H C;  3RN1 C;  2IUP D;  2AH0 D;  2H3X B;  2Q7Q D;  4L3G C;  2OIZ D;  3PXW C;  2BBK L;  2HXC D;  2IUQ D;  2AGZ D;  2J56 L;  1MG2 B;  1MAE L;  2OK4 D;  4K3I C;  4FAN C;  3SVW C;  4FA4 C;  2AGW D;  1MAF L;  1MG3 B;  2AGY D;  2IUV D;  3RN0 C;  3RMZ C;  4FA9 C;  4FB1 C;  2H47 B;  2J55 L;  2MTA L;  3L4M C;  3ORV C;  2AH1 D;  2MAD L;  4FA5 C;  2OK6 D;  2I0S D;  2HKR D;  3PXT C;  2AGX D; 
#chains in the Genus database with same CATH topology
 2I0T D;  2OJY D;  3PXS C;  4L1Q C;  2IAA B;  4FAV C;  3SLE C;  3RLM C;  3SJL C;  2HKM D;  3SWS C;  2I0R D;  3C75 L;  2GC7 B;  2IUR D;  2J57 K;  2GC4 B;  4Y5R C;  2AGL D;  4FA1 C;  3L4O C;  3SXT C;  1MDA L;  2HJ4 D;  4O1Q C;  2HJB D;  4L3H C;  3RN1 C;  2IUP D;  2AH0 D;  2H3X B;  2Q7Q D;  4L3G C;  2OIZ D;  3PXW C;  2BBK L;  2HXC D;  2IUQ D;  2AGZ D;  2J56 L;  1MG2 B;  1MAE L;  2OK4 D;  4K3I C;  4FAN C;  3SVW C;  4FA4 C;  2AGW D;  1MAF L;  1MG3 B;  2AGY D;  2IUV D;  3RN0 C;  3RMZ C;  4FA9 C;  4FB1 C;  2H47 B;  2J55 L;  2MTA L;  3L4M C;  3ORV C;  2AH1 D;  2MAD L;  4FA5 C;  2OK6 D;  2I0S D;  2HKR D;  3PXT C;  2AGX D; 
#chains in the Genus database with same CATH homology
 2I0T D;  2OJY D;  3PXS C;  4L1Q C;  2IAA B;  4FAV C;  3SLE C;  3RLM C;  3SJL C;  2HKM D;  3SWS C;  2I0R D;  3C75 L;  2GC7 B;  2IUR D;  2J57 K;  2GC4 B;  4Y5R C;  2AGL D;  4FA1 C;  3L4O C;  3SXT C;  1MDA L;  2HJ4 D;  4O1Q C;  2HJB D;  4L3H C;  3RN1 C;  2IUP D;  2AH0 D;  2H3X B;  2Q7Q D;  4L3G C;  2OIZ D;  3PXW C;  2BBK L;  2HXC D;  2IUQ D;  2AGZ D;  2J56 L;  1MG2 B;  1MAE L;  2OK4 D;  4K3I C;  4FAN C;  3SVW C;  4FA4 C;  2AGW D;  1MAF L;  1MG3 B;  2AGY D;  2IUV D;  3RN0 C;  3RMZ C;  4FA9 C;  4FB1 C;  2H47 B;  2J55 L;  2MTA L;  3L4M C;  3ORV C;  2AH1 D;  2MAD L;  4FA5 C;  2OK6 D;  2I0S D;  2HKR D;  3PXT C;  2AGX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...