2HJBD

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 25
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hjbD00
3C75L 2AH0D 2I0RD 4FA1C 1MG3B 2OIZD 3L4MC 3RN0C 2HKMD 4FA4C 3SVWC 4O1QC 2HJBD 4Y5RC 2GC4B 2J57K 2H47B 2IURD 2OJYD 3PXSC 3SLEC 2J55L 2AH1D 2I0TD 2J56L 4L3HC 3SJLC 2MTAL 2HKRD 4K3IC 4FB1C 1MAEL 2AGYD 2HJ4D 2AGLD 3SXTC 3L4OC 3PXWC 1MG2B 2H3XB 2HXCD 3RMZC 4L3GC 3ORVC 3RLMC 4FANC 4FA9C 4FAVC 3SWSC 2BBKL 2IUQD 3RN1C 2IUPD 2AGZD 2IUVD 2AGWD 4FA5C 2GC7B 1MAFL 1MDAL 2IAAB 2Q7QD 3PXTC 2OK4D 2MADL 2OK6D 2AGXD 2I0SD 4L1QC
chains in the Genus database with same CATH superfamily
3C75L 2AH0D 2I0RD 4FA1C 1MG3B 2OIZD 3L4MC 3RN0C 2HKMD 4FA4C 3SVWC 4O1QC 2HJBD 4Y5RC 2GC4B 2J57K 2H47B 2IURD 2OJYD 3PXSC 3SLEC 2J55L 2AH1D 2I0TD 2J56L 4L3HC 3SJLC 2MTAL 2HKRD 4K3IC 4FB1C 1MAEL 2AGYD 2HJ4D 2AGLD 3SXTC 3L4OC 3PXWC 1MG2B 2H3XB 2HXCD 3RMZC 4L3GC 3ORVC 3RLMC 4FANC 4FA9C 4FAVC 3SWSC 2BBKL 2IUQD 3RN1C 2IUPD 2AGZD 2IUVD 2AGWD 4FA5C 2GC7B 1MAFL 1MDAL 2IAAB 2Q7QD 3PXTC 2OK4D 2MADL 2OK6D 2AGXD 2I0SD 4L1QC
chains in the Genus database with same CATH topology
3C75L 2AH0D 2I0RD 4FA1C 1MG3B 2OIZD 3L4MC 3RN0C 2HKMD 4FA4C 3SVWC 4O1QC 2HJBD 4Y5RC 2GC4B 2J57K 2H47B 2IURD 2OJYD 3PXSC 3SLEC 2J55L 2AH1D 2I0TD 2J56L 4L3HC 3SJLC 2MTAL 2HKRD 4K3IC 4FB1C 1MAEL 2AGYD 2HJ4D 2AGLD 3SXTC 3L4OC 3PXWC 1MG2B 2H3XB 2HXCD 3RMZC 4L3GC 3ORVC 3RLMC 4FANC 4FA9C 4FAVC 3SWSC 2BBKL 2IUQD 3RN1C 2IUPD 2AGZD 2IUVD 2AGWD 4FA5C 2GC7B 1MAFL 1MDAL 2IAAB 2Q7QD 3PXTC 2OK4D 2MADL 2OK6D 2AGXD 2I0SD 4L1QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C75 L;  2AH0 D;  2I0R D;  4FA1 C;  1MG3 B;  2OIZ D;  3L4M C;  3RN0 C;  2HKM D;  4FA4 C;  3SVW C;  4O1Q C;  2HJB D;  4Y5R C;  2GC4 B;  2J57 K;  2H47 B;  2IUR D;  2OJY D;  3PXS C;  3SLE C;  2J55 L;  2AH1 D;  2I0T D;  2J56 L;  4L3H C;  3SJL C;  2MTA L;  2HKR D;  4K3I C;  4FB1 C;  1MAE L;  2AGY D;  2HJ4 D;  2AGL D;  3SXT C;  3L4O C;  3PXW C;  1MG2 B;  2H3X B;  2HXC D;  3RMZ C;  4L3G C;  3ORV C;  3RLM C;  4FAN C;  4FA9 C;  4FAV C;  3SWS C;  2BBK L;  2IUQ D;  3RN1 C;  2IUP D;  2AGZ D;  2IUV D;  2AGW D;  4FA5 C;  2GC7 B;  1MAF L;  1MDA L;  2IAA B;  2Q7Q D;  3PXT C;  2OK4 D;  2MAD L;  2OK6 D;  2AGX D;  2I0S D;  4L1Q C; 
#chains in the Genus database with same CATH topology
 3C75 L;  2AH0 D;  2I0R D;  4FA1 C;  1MG3 B;  2OIZ D;  3L4M C;  3RN0 C;  2HKM D;  4FA4 C;  3SVW C;  4O1Q C;  2HJB D;  4Y5R C;  2GC4 B;  2J57 K;  2H47 B;  2IUR D;  2OJY D;  3PXS C;  3SLE C;  2J55 L;  2AH1 D;  2I0T D;  2J56 L;  4L3H C;  3SJL C;  2MTA L;  2HKR D;  4K3I C;  4FB1 C;  1MAE L;  2AGY D;  2HJ4 D;  2AGL D;  3SXT C;  3L4O C;  3PXW C;  1MG2 B;  2H3X B;  2HXC D;  3RMZ C;  4L3G C;  3ORV C;  3RLM C;  4FAN C;  4FA9 C;  4FAV C;  3SWS C;  2BBK L;  2IUQ D;  3RN1 C;  2IUP D;  2AGZ D;  2IUV D;  2AGW D;  4FA5 C;  2GC7 B;  1MAF L;  1MDA L;  2IAA B;  2Q7Q D;  3PXT C;  2OK4 D;  2MAD L;  2OK6 D;  2AGX D;  2I0S D;  4L1Q C; 
#chains in the Genus database with same CATH homology
 3C75 L;  2AH0 D;  2I0R D;  4FA1 C;  1MG3 B;  2OIZ D;  3L4M C;  3RN0 C;  2HKM D;  4FA4 C;  3SVW C;  4O1Q C;  2HJB D;  4Y5R C;  2GC4 B;  2J57 K;  2H47 B;  2IUR D;  2OJY D;  3PXS C;  3SLE C;  2J55 L;  2AH1 D;  2I0T D;  2J56 L;  4L3H C;  3SJL C;  2MTA L;  2HKR D;  4K3I C;  4FB1 C;  1MAE L;  2AGY D;  2HJ4 D;  2AGL D;  3SXT C;  3L4O C;  3PXW C;  1MG2 B;  2H3X B;  2HXC D;  3RMZ C;  4L3G C;  3ORV C;  3RLM C;  4FAN C;  4FA9 C;  4FAV C;  3SWS C;  2BBK L;  2IUQ D;  3RN1 C;  2IUP D;  2AGZ D;  2IUV D;  2AGW D;  4FA5 C;  2GC7 B;  1MAF L;  1MDA L;  2IAA B;  2Q7Q D;  3PXT C;  2OK4 D;  2MAD L;  2OK6 D;  2AGX D;  2I0S D;  4L1Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...