2HJBD

Crystal structure of alcaligenes faecalis aadh in complex with p-methoxybenzylamine
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hjbD00
4FA1C 3SVWC 2I0TD 4Y5RC 2MADL 2OJYD 2Q7QD 4FANC 3PXWC 2BBKL 1MAFL 3L4OC 2AH1D 3SXTC 2H47B 3ORVC 3SJLC 3SLEC 2AGLD 2AGYD 4FB1C 3PXSC 2HKMD 2OK4D 4FA4C 4L1QC 4L3HC 2I0RD 2J56L 2OIZD 3L4MC 2AH0D 2I0SD 2AGZD 1MAEL 2IURD 4L3GC 4FA5C 2HJBD 2IUVD 2HKRD 2J57K 3PXTC 4K3IC 3RMZC 1MDAL 3RN1C 4FA9C 4O1QC 3C75L 3RN0C 2IUPD 2GC7B 3SWSC 2HXCD 2IUQD 2J55L 2HJ4D 2AGXD 1MG2B 2MTAL 2AGWD 1MG3B 2GC4B 3RLMC 2IAAB 2H3XB 2OK6D 4FAVC
chains in the Genus database with same CATH superfamily
4FA1C 3SVWC 2I0TD 4Y5RC 2MADL 2OJYD 2Q7QD 4FANC 3PXWC 2BBKL 1MAFL 3L4OC 2AH1D 3SXTC 2H47B 3ORVC 3SJLC 3SLEC 2AGLD 2AGYD 4FB1C 3PXSC 2HKMD 2OK4D 4FA4C 4L1QC 4L3HC 2I0RD 2J56L 2OIZD 3L4MC 2AH0D 2I0SD 2AGZD 1MAEL 2IURD 4L3GC 4FA5C 2HJBD 2IUVD 2HKRD 2J57K 3PXTC 4K3IC 3RMZC 1MDAL 3RN1C 4FA9C 4O1QC 3C75L 3RN0C 2IUPD 2GC7B 3SWSC 2HXCD 2IUQD 2J55L 2HJ4D 2AGXD 1MG2B 2MTAL 2AGWD 1MG3B 2GC4B 3RLMC 2IAAB 2H3XB 2OK6D 4FAVC
chains in the Genus database with same CATH topology
4FA1C 3SVWC 2I0TD 4Y5RC 2MADL 2OJYD 2Q7QD 4FANC 3PXWC 2BBKL 1MAFL 3L4OC 2AH1D 3SXTC 2H47B 3ORVC 3SJLC 3SLEC 2AGLD 2AGYD 4FB1C 3PXSC 2HKMD 2OK4D 4FA4C 4L1QC 4L3HC 2I0RD 2J56L 2OIZD 3L4MC 2AH0D 2I0SD 2AGZD 1MAEL 2IURD 4L3GC 4FA5C 2HJBD 2IUVD 2HKRD 2J57K 3PXTC 4K3IC 3RMZC 1MDAL 3RN1C 4FA9C 4O1QC 3C75L 3RN0C 2IUPD 2GC7B 3SWSC 2HXCD 2IUQD 2J55L 2HJ4D 2AGXD 1MG2B 2MTAL 2AGWD 1MG3B 2GC4B 3RLMC 2IAAB 2H3XB 2OK6D 4FAVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA1 C;  3SVW C;  2I0T D;  4Y5R C;  2MAD L;  2OJY D;  2Q7Q D;  4FAN C;  3PXW C;  2BBK L;  1MAF L;  3L4O C;  2AH1 D;  3SXT C;  2H47 B;  3ORV C;  3SJL C;  3SLE C;  2AGL D;  2AGY D;  4FB1 C;  3PXS C;  2HKM D;  2OK4 D;  4FA4 C;  4L1Q C;  4L3H C;  2I0R D;  2J56 L;  2OIZ D;  3L4M C;  2AH0 D;  2I0S D;  2AGZ D;  1MAE L;  2IUR D;  4L3G C;  4FA5 C;  2HJB D;  2IUV D;  2HKR D;  2J57 K;  3PXT C;  4K3I C;  3RMZ C;  1MDA L;  3RN1 C;  4FA9 C;  4O1Q C;  3C75 L;  3RN0 C;  2IUP D;  2GC7 B;  3SWS C;  2HXC D;  2IUQ D;  2J55 L;  2HJ4 D;  2AGX D;  1MG2 B;  2MTA L;  2AGW D;  1MG3 B;  2GC4 B;  3RLM C;  2IAA B;  2H3X B;  2OK6 D;  4FAV C; 
#chains in the Genus database with same CATH topology
 4FA1 C;  3SVW C;  2I0T D;  4Y5R C;  2MAD L;  2OJY D;  2Q7Q D;  4FAN C;  3PXW C;  2BBK L;  1MAF L;  3L4O C;  2AH1 D;  3SXT C;  2H47 B;  3ORV C;  3SJL C;  3SLE C;  2AGL D;  2AGY D;  4FB1 C;  3PXS C;  2HKM D;  2OK4 D;  4FA4 C;  4L1Q C;  4L3H C;  2I0R D;  2J56 L;  2OIZ D;  3L4M C;  2AH0 D;  2I0S D;  2AGZ D;  1MAE L;  2IUR D;  4L3G C;  4FA5 C;  2HJB D;  2IUV D;  2HKR D;  2J57 K;  3PXT C;  4K3I C;  3RMZ C;  1MDA L;  3RN1 C;  4FA9 C;  4O1Q C;  3C75 L;  3RN0 C;  2IUP D;  2GC7 B;  3SWS C;  2HXC D;  2IUQ D;  2J55 L;  2HJ4 D;  2AGX D;  1MG2 B;  2MTA L;  2AGW D;  1MG3 B;  2GC4 B;  3RLM C;  2IAA B;  2H3X B;  2OK6 D;  4FAV C; 
#chains in the Genus database with same CATH homology
 4FA1 C;  3SVW C;  2I0T D;  4Y5R C;  2MAD L;  2OJY D;  2Q7Q D;  4FAN C;  3PXW C;  2BBK L;  1MAF L;  3L4O C;  2AH1 D;  3SXT C;  2H47 B;  3ORV C;  3SJL C;  3SLE C;  2AGL D;  2AGY D;  4FB1 C;  3PXS C;  2HKM D;  2OK4 D;  4FA4 C;  4L1Q C;  4L3H C;  2I0R D;  2J56 L;  2OIZ D;  3L4M C;  2AH0 D;  2I0S D;  2AGZ D;  1MAE L;  2IUR D;  4L3G C;  4FA5 C;  2HJB D;  2IUV D;  2HKR D;  2J57 K;  3PXT C;  4K3I C;  3RMZ C;  1MDA L;  3RN1 C;  4FA9 C;  4O1Q C;  3C75 L;  3RN0 C;  2IUP D;  2GC7 B;  3SWS C;  2HXC D;  2IUQ D;  2J55 L;  2HJ4 D;  2AGX D;  1MG2 B;  2MTA L;  2AGW D;  1MG3 B;  2GC4 B;  3RLM C;  2IAA B;  2H3X B;  2OK6 D;  4FAV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...