2AGZD

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. f222 form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
108
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 108
sequence length 109
chains with identical sequence H
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agzD00
2Q7QD 4FA4C 3PXWC 1MDAL 2IAAB 2IUPD 1MAEL 2BBKL 2H3XB 2HKRD 2H47B 3SVWC 3C75L 2I0SD 2OK6D 4L3GC 4L3HC 4FAVC 4FA9C 2J57K 3RMZC 2GC4B 3RN0C 3RLMC 4L1QC 4Y5RC 2J55L 2MTAL 2GC7B 2HJBD 1MG3B 2IUQD 2OIZD 1MAFL 2HXCD 2HJ4D 1MG2B 2I0RD 2J56L 3L4OC 3ORVC 2OK4D 3SLEC 4FANC 4FB1C 3SWSC 2AH1D 2HKMD 2AGXD 2AH0D 2AGLD 2AGYD 2OJYD 4FA5C 2IUVD 4O1QC 2AGWD 3PXSC 3PXTC 4K3IC 3SJLC 2MADL 3L4MC 2I0TD 4FA1C 2IURD 2AGZD 3SXTC 3RN1C
chains in the Genus database with same CATH superfamily
2Q7QD 4FA4C 3PXWC 1MDAL 2IAAB 2IUPD 1MAEL 2BBKL 2H3XB 2HKRD 2H47B 3SVWC 3C75L 2I0SD 2OK6D 4L3GC 4L3HC 4FAVC 4FA9C 2J57K 3RMZC 2GC4B 3RN0C 3RLMC 4L1QC 4Y5RC 2J55L 2MTAL 2GC7B 2HJBD 1MG3B 2IUQD 2OIZD 1MAFL 2HXCD 2HJ4D 1MG2B 2I0RD 2J56L 3L4OC 3ORVC 2OK4D 3SLEC 4FANC 4FB1C 3SWSC 2AH1D 2HKMD 2AGXD 2AH0D 2AGLD 2AGYD 2OJYD 4FA5C 2IUVD 4O1QC 2AGWD 3PXSC 3PXTC 4K3IC 3SJLC 2MADL 3L4MC 2I0TD 4FA1C 2IURD 2AGZD 3SXTC 3RN1C
chains in the Genus database with same CATH topology
2Q7QD 4FA4C 3PXWC 1MDAL 2IAAB 2IUPD 1MAEL 2BBKL 2H3XB 2HKRD 2H47B 3SVWC 3C75L 2I0SD 2OK6D 4L3GC 4L3HC 4FAVC 4FA9C 2J57K 3RMZC 2GC4B 3RN0C 3RLMC 4L1QC 4Y5RC 2J55L 2MTAL 2GC7B 2HJBD 1MG3B 2IUQD 2OIZD 1MAFL 2HXCD 2HJ4D 1MG2B 2I0RD 2J56L 3L4OC 3ORVC 2OK4D 3SLEC 4FANC 4FB1C 3SWSC 2AH1D 2HKMD 2AGXD 2AH0D 2AGLD 2AGYD 2OJYD 4FA5C 2IUVD 4O1QC 2AGWD 3PXSC 3PXTC 4K3IC 3SJLC 2MADL 3L4MC 2I0TD 4FA1C 2IURD 2AGZD 3SXTC 3RN1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7Q D;  4FA4 C;  3PXW C;  1MDA L;  2IAA B;  2IUP D;  1MAE L;  2BBK L;  2H3X B;  2HKR D;  2H47 B;  3SVW C;  3C75 L;  2I0S D;  2OK6 D;  4L3G C;  4L3H C;  4FAV C;  4FA9 C;  2J57 K;  3RMZ C;  2GC4 B;  3RN0 C;  3RLM C;  4L1Q C;  4Y5R C;  2J55 L;  2MTA L;  2GC7 B;  2HJB D;  1MG3 B;  2IUQ D;  2OIZ D;  1MAF L;  2HXC D;  2HJ4 D;  1MG2 B;  2I0R D;  2J56 L;  3L4O C;  3ORV C;  2OK4 D;  3SLE C;  4FAN C;  4FB1 C;  3SWS C;  2AH1 D;  2HKM D;  2AGX D;  2AH0 D;  2AGL D;  2AGY D;  2OJY D;  4FA5 C;  2IUV D;  4O1Q C;  2AGW D;  3PXS C;  3PXT C;  4K3I C;  3SJL C;  2MAD L;  3L4M C;  2I0T D;  4FA1 C;  2IUR D;  2AGZ D;  3SXT C;  3RN1 C; 
#chains in the Genus database with same CATH topology
 2Q7Q D;  4FA4 C;  3PXW C;  1MDA L;  2IAA B;  2IUP D;  1MAE L;  2BBK L;  2H3X B;  2HKR D;  2H47 B;  3SVW C;  3C75 L;  2I0S D;  2OK6 D;  4L3G C;  4L3H C;  4FAV C;  4FA9 C;  2J57 K;  3RMZ C;  2GC4 B;  3RN0 C;  3RLM C;  4L1Q C;  4Y5R C;  2J55 L;  2MTA L;  2GC7 B;  2HJB D;  1MG3 B;  2IUQ D;  2OIZ D;  1MAF L;  2HXC D;  2HJ4 D;  1MG2 B;  2I0R D;  2J56 L;  3L4O C;  3ORV C;  2OK4 D;  3SLE C;  4FAN C;  4FB1 C;  3SWS C;  2AH1 D;  2HKM D;  2AGX D;  2AH0 D;  2AGL D;  2AGY D;  2OJY D;  4FA5 C;  2IUV D;  4O1Q C;  2AGW D;  3PXS C;  3PXT C;  4K3I C;  3SJL C;  2MAD L;  3L4M C;  2I0T D;  4FA1 C;  2IUR D;  2AGZ D;  3SXT C;  3RN1 C; 
#chains in the Genus database with same CATH homology
 2Q7Q D;  4FA4 C;  3PXW C;  1MDA L;  2IAA B;  2IUP D;  1MAE L;  2BBK L;  2H3X B;  2HKR D;  2H47 B;  3SVW C;  3C75 L;  2I0S D;  2OK6 D;  4L3G C;  4L3H C;  4FAV C;  4FA9 C;  2J57 K;  3RMZ C;  2GC4 B;  3RN0 C;  3RLM C;  4L1Q C;  4Y5R C;  2J55 L;  2MTA L;  2GC7 B;  2HJB D;  1MG3 B;  2IUQ D;  2OIZ D;  1MAF L;  2HXC D;  2HJ4 D;  1MG2 B;  2I0R D;  2J56 L;  3L4O C;  3ORV C;  2OK4 D;  3SLE C;  4FAN C;  4FB1 C;  3SWS C;  2AH1 D;  2HKM D;  2AGX D;  2AH0 D;  2AGL D;  2AGY D;  2OJY D;  4FA5 C;  2IUV D;  4O1Q C;  2AGW D;  3PXS C;  3PXT C;  4K3I C;  3SJL C;  2MAD L;  3L4M C;  2I0T D;  4FA1 C;  2IUR D;  2AGZ D;  3SXT C;  3RN1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...