2AGZD

Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with tryptamine. f222 form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 28
structure length 108
sequence length 109
chains with identical sequence H
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agzD00
3SVWC 2MTAL 2J57K 2AGLD 2AGXD 3RLMC 4Y5RC 2OIZD 3L4OC 4FA9C 2HKRD 1MG3B 2IAAB 2J55L 3C75L 4L1QC 3RMZC 3PXSC 2GC4B 2HKMD 2AGWD 1MDAL 4FAVC 2OJYD 4FB1C 3SJLC 2AGYD 3RN0C 2IURD 2IUQD 3SLEC 4FA4C 2J56L 2Q7QD 2H47B 2AGZD 3RN1C 4K3IC 3SWSC 3PXWC 4L3GC 2HXCD 4FA5C 3ORVC 3PXTC 1MAFL 2AH0D 2IUVD 4L3HC 2IUPD 4FANC 1MG2B 1MAEL 2OK4D 2I0SD 2AH1D 4FA1C 2H3XB 3L4MC 2OK6D 2MADL 3SXTC 2GC7B 2I0TD 2HJ4D 2HJBD 2BBKL 4O1QC 2I0RD
chains in the Genus database with same CATH superfamily
3SVWC 2MTAL 2J57K 2AGLD 2AGXD 3RLMC 4Y5RC 2OIZD 3L4OC 4FA9C 2HKRD 1MG3B 2IAAB 2J55L 3C75L 4L1QC 3RMZC 3PXSC 2GC4B 2HKMD 2AGWD 1MDAL 4FAVC 2OJYD 4FB1C 3SJLC 2AGYD 3RN0C 2IURD 2IUQD 3SLEC 4FA4C 2J56L 2Q7QD 2H47B 2AGZD 3RN1C 4K3IC 3SWSC 3PXWC 4L3GC 2HXCD 4FA5C 3ORVC 3PXTC 1MAFL 2AH0D 2IUVD 4L3HC 2IUPD 4FANC 1MG2B 1MAEL 2OK4D 2I0SD 2AH1D 4FA1C 2H3XB 3L4MC 2OK6D 2MADL 3SXTC 2GC7B 2I0TD 2HJ4D 2HJBD 2BBKL 4O1QC 2I0RD
chains in the Genus database with same CATH topology
3SVWC 2MTAL 2J57K 2AGLD 2AGXD 3RLMC 4Y5RC 2OIZD 3L4OC 4FA9C 2HKRD 1MG3B 2IAAB 2J55L 3C75L 4L1QC 3RMZC 3PXSC 2GC4B 2HKMD 2AGWD 1MDAL 4FAVC 2OJYD 4FB1C 3SJLC 2AGYD 3RN0C 2IURD 2IUQD 3SLEC 4FA4C 2J56L 2Q7QD 2H47B 2AGZD 3RN1C 4K3IC 3SWSC 3PXWC 4L3GC 2HXCD 4FA5C 3ORVC 3PXTC 1MAFL 2AH0D 2IUVD 4L3HC 2IUPD 4FANC 1MG2B 1MAEL 2OK4D 2I0SD 2AH1D 4FA1C 2H3XB 3L4MC 2OK6D 2MADL 3SXTC 2GC7B 2I0TD 2HJ4D 2HJBD 2BBKL 4O1QC 2I0RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SVW C;  2MTA L;  2J57 K;  2AGL D;  2AGX D;  3RLM C;  4Y5R C;  2OIZ D;  3L4O C;  4FA9 C;  2HKR D;  1MG3 B;  2IAA B;  2J55 L;  3C75 L;  4L1Q C;  3RMZ C;  3PXS C;  2GC4 B;  2HKM D;  2AGW D;  1MDA L;  4FAV C;  2OJY D;  4FB1 C;  3SJL C;  2AGY D;  3RN0 C;  2IUR D;  2IUQ D;  3SLE C;  4FA4 C;  2J56 L;  2Q7Q D;  2H47 B;  2AGZ D;  3RN1 C;  4K3I C;  3SWS C;  3PXW C;  4L3G C;  2HXC D;  4FA5 C;  3ORV C;  3PXT C;  1MAF L;  2AH0 D;  2IUV D;  4L3H C;  2IUP D;  4FAN C;  1MG2 B;  1MAE L;  2OK4 D;  2I0S D;  2AH1 D;  4FA1 C;  2H3X B;  3L4M C;  2OK6 D;  2MAD L;  3SXT C;  2GC7 B;  2I0T D;  2HJ4 D;  2HJB D;  2BBK L;  4O1Q C;  2I0R D; 
#chains in the Genus database with same CATH topology
 3SVW C;  2MTA L;  2J57 K;  2AGL D;  2AGX D;  3RLM C;  4Y5R C;  2OIZ D;  3L4O C;  4FA9 C;  2HKR D;  1MG3 B;  2IAA B;  2J55 L;  3C75 L;  4L1Q C;  3RMZ C;  3PXS C;  2GC4 B;  2HKM D;  2AGW D;  1MDA L;  4FAV C;  2OJY D;  4FB1 C;  3SJL C;  2AGY D;  3RN0 C;  2IUR D;  2IUQ D;  3SLE C;  4FA4 C;  2J56 L;  2Q7Q D;  2H47 B;  2AGZ D;  3RN1 C;  4K3I C;  3SWS C;  3PXW C;  4L3G C;  2HXC D;  4FA5 C;  3ORV C;  3PXT C;  1MAF L;  2AH0 D;  2IUV D;  4L3H C;  2IUP D;  4FAN C;  1MG2 B;  1MAE L;  2OK4 D;  2I0S D;  2AH1 D;  4FA1 C;  2H3X B;  3L4M C;  2OK6 D;  2MAD L;  3SXT C;  2GC7 B;  2I0T D;  2HJ4 D;  2HJB D;  2BBK L;  4O1Q C;  2I0R D; 
#chains in the Genus database with same CATH homology
 3SVW C;  2MTA L;  2J57 K;  2AGL D;  2AGX D;  3RLM C;  4Y5R C;  2OIZ D;  3L4O C;  4FA9 C;  2HKR D;  1MG3 B;  2IAA B;  2J55 L;  3C75 L;  4L1Q C;  3RMZ C;  3PXS C;  2GC4 B;  2HKM D;  2AGW D;  1MDA L;  4FAV C;  2OJY D;  4FB1 C;  3SJL C;  2AGY D;  3RN0 C;  2IUR D;  2IUQ D;  3SLE C;  4FA4 C;  2J56 L;  2Q7Q D;  2H47 B;  2AGZ D;  3RN1 C;  4K3I C;  3SWS C;  3PXW C;  4L3G C;  2HXC D;  4FA5 C;  3ORV C;  3PXT C;  1MAF L;  2AH0 D;  2IUV D;  4L3H C;  2IUP D;  4FAN C;  1MG2 B;  1MAE L;  2OK4 D;  2I0S D;  2AH1 D;  4FA1 C;  2H3X B;  3L4M C;  2OK6 D;  2MAD L;  3SXT C;  2GC7 B;  2I0T D;  2HJ4 D;  2HJB D;  2BBK L;  4O1Q C;  2I0R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...