1MAFL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
123
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
source organism Paracoccus versutus
molecule tags Oxidoreductase(chnh2(d)-deaminating)
total genus 29
structure length 123
sequence length 124
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 1mafL00
2H3XB 4FANC 3PXTC 3RLMC 4L3HC 3L4MC 3RN0C 2AH1D 2AGWD 2I0TD 2HJBD 2HJ4D 4FA9C 2J55L 3C75L 2IAAB 2IURD 4FA4C 2OIZD 2HKMD 2AGYD 2AH0D 1MG3B 3SVWC 1MG2B 2IUVD 4O1QC 2HXCD 2MADL 2I0RD 2AGLD 4FAVC 4Y5RC 2IUPD 2BBKL 3SLEC 2GC4B 4L1QC 2AGZD 2GC7B 2H47B 3ORVC 2AGXD 2HKRD 1MAEL 4FB1C 3PXSC 2OJYD 3L4OC 1MAFL 1MDAL 2MTAL 2I0SD 3PXWC 4L3GC 3RMZC 3SJLC 3SWSC 2J56L 2J57K 2OK6D 4K3IC 3RN1C 3SXTC 4FA5C 4FA1C 2Q7QD 2OK4D 2IUQD
chains in the Genus database with same CATH superfamily
2H3XB 4FANC 3PXTC 3RLMC 4L3HC 3L4MC 3RN0C 2AH1D 2AGWD 2I0TD 2HJBD 2HJ4D 4FA9C 2J55L 3C75L 2IAAB 2IURD 4FA4C 2OIZD 2HKMD 2AGYD 2AH0D 1MG3B 3SVWC 1MG2B 2IUVD 4O1QC 2HXCD 2MADL 2I0RD 2AGLD 4FAVC 4Y5RC 2IUPD 2BBKL 3SLEC 2GC4B 4L1QC 2AGZD 2GC7B 2H47B 3ORVC 2AGXD 2HKRD 1MAEL 4FB1C 3PXSC 2OJYD 3L4OC 1MAFL 1MDAL 2MTAL 2I0SD 3PXWC 4L3GC 3RMZC 3SJLC 3SWSC 2J56L 2J57K 2OK6D 4K3IC 3RN1C 3SXTC 4FA5C 4FA1C 2Q7QD 2OK4D 2IUQD
chains in the Genus database with same CATH topology
2H3XB 4FANC 3PXTC 3RLMC 4L3HC 3L4MC 3RN0C 2AH1D 2AGWD 2I0TD 2HJBD 2HJ4D 4FA9C 2J55L 3C75L 2IAAB 2IURD 4FA4C 2OIZD 2HKMD 2AGYD 2AH0D 1MG3B 3SVWC 1MG2B 2IUVD 4O1QC 2HXCD 2MADL 2I0RD 2AGLD 4FAVC 4Y5RC 2IUPD 2BBKL 3SLEC 2GC4B 4L1QC 2AGZD 2GC7B 2H47B 3ORVC 2AGXD 2HKRD 1MAEL 4FB1C 3PXSC 2OJYD 3L4OC 1MAFL 1MDAL 2MTAL 2I0SD 3PXWC 4L3GC 3RMZC 3SJLC 3SWSC 2J56L 2J57K 2OK6D 4K3IC 3RN1C 3SXTC 4FA5C 4FA1C 2Q7QD 2OK4D 2IUQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3X B;  4FAN C;  3PXT C;  3RLM C;  4L3H C;  3L4M C;  3RN0 C;  2AH1 D;  2AGW D;  2I0T D;  2HJB D;  2HJ4 D;  4FA9 C;  2J55 L;  3C75 L;  2IAA B;  2IUR D;  4FA4 C;  2OIZ D;  2HKM D;  2AGY D;  2AH0 D;  1MG3 B;  3SVW C;  1MG2 B;  2IUV D;  4O1Q C;  2HXC D;  2MAD L;  2I0R D;  2AGL D;  4FAV C;  4Y5R C;  2IUP D;  2BBK L;  3SLE C;  2GC4 B;  4L1Q C;  2AGZ D;  2GC7 B;  2H47 B;  3ORV C;  2AGX D;  2HKR D;  1MAE L;  4FB1 C;  3PXS C;  2OJY D;  3L4O C;  1MAF L;  1MDA L;  2MTA L;  2I0S D;  3PXW C;  4L3G C;  3RMZ C;  3SJL C;  3SWS C;  2J56 L;  2J57 K;  2OK6 D;  4K3I C;  3RN1 C;  3SXT C;  4FA5 C;  4FA1 C;  2Q7Q D;  2OK4 D;  2IUQ D; 
#chains in the Genus database with same CATH topology
 2H3X B;  4FAN C;  3PXT C;  3RLM C;  4L3H C;  3L4M C;  3RN0 C;  2AH1 D;  2AGW D;  2I0T D;  2HJB D;  2HJ4 D;  4FA9 C;  2J55 L;  3C75 L;  2IAA B;  2IUR D;  4FA4 C;  2OIZ D;  2HKM D;  2AGY D;  2AH0 D;  1MG3 B;  3SVW C;  1MG2 B;  2IUV D;  4O1Q C;  2HXC D;  2MAD L;  2I0R D;  2AGL D;  4FAV C;  4Y5R C;  2IUP D;  2BBK L;  3SLE C;  2GC4 B;  4L1Q C;  2AGZ D;  2GC7 B;  2H47 B;  3ORV C;  2AGX D;  2HKR D;  1MAE L;  4FB1 C;  3PXS C;  2OJY D;  3L4O C;  1MAF L;  1MDA L;  2MTA L;  2I0S D;  3PXW C;  4L3G C;  3RMZ C;  3SJL C;  3SWS C;  2J56 L;  2J57 K;  2OK6 D;  4K3I C;  3RN1 C;  3SXT C;  4FA5 C;  4FA1 C;  2Q7Q D;  2OK4 D;  2IUQ D; 
#chains in the Genus database with same CATH homology
 2H3X B;  4FAN C;  3PXT C;  3RLM C;  4L3H C;  3L4M C;  3RN0 C;  2AH1 D;  2AGW D;  2I0T D;  2HJB D;  2HJ4 D;  4FA9 C;  2J55 L;  3C75 L;  2IAA B;  2IUR D;  4FA4 C;  2OIZ D;  2HKM D;  2AGY D;  2AH0 D;  1MG3 B;  3SVW C;  1MG2 B;  2IUV D;  4O1Q C;  2HXC D;  2MAD L;  2I0R D;  2AGL D;  4FAV C;  4Y5R C;  2IUP D;  2BBK L;  3SLE C;  2GC4 B;  4L1Q C;  2AGZ D;  2GC7 B;  2H47 B;  3ORV C;  2AGX D;  2HKR D;  1MAE L;  4FB1 C;  3PXS C;  2OJY D;  3L4O C;  1MAF L;  1MDA L;  2MTA L;  2I0S D;  3PXW C;  4L3G C;  3RMZ C;  3SJL C;  3SWS C;  2J56 L;  2J57 K;  2OK6 D;  4K3I C;  3RN1 C;  3SXT C;  4FA5 C;  4FA1 C;  2Q7Q D;  2OK4 D;  2IUQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...