1MAFL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
123
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(chnh2(d)-deaminating)
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
source organism Paracoccus versutus
total genus 29
structure length 123
sequence length 124
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 1mafL00
2IUVD 2OJYD 2HJBD 2MADL 4O1QC 2BBKL 2HXCD 3SJLC 4FA5C 1MAFL 2J57K 3PXWC 2AH1D 2AGLD 3RN1C 3SVWC 3RN0C 3SWSC 2H3XB 2GC7B 2HKRD 2Q7QD 2MTAL 2IUQD 2HJ4D 1MAEL 1MG2B 1MDAL 3L4MC 3SXTC 4Y5RC 2OK6D 2AGZD 3PXTC 2H47B 3ORVC 4FA9C 4FAVC 2HKMD 2AGWD 2AH0D 3L4OC 4L1QC 2AGYD 2GC4B 4FA4C 2I0RD 2IUPD 2IURD 1MG3B 2IAAB 3PXSC 2J55L 2I0SD 2OK4D 2AGXD 3RMZC 3SLEC 4FA1C 4FANC 3RLMC 4FB1C 4L3HC 2J56L 2OIZD 4K3IC 4L3GC 3C75L 2I0TD
chains in the Genus database with same CATH superfamily
2IUVD 2OJYD 2HJBD 2MADL 4O1QC 2BBKL 2HXCD 3SJLC 4FA5C 1MAFL 2J57K 3PXWC 2AH1D 2AGLD 3RN1C 3SVWC 3RN0C 3SWSC 2H3XB 2GC7B 2HKRD 2Q7QD 2MTAL 2IUQD 2HJ4D 1MAEL 1MG2B 1MDAL 3L4MC 3SXTC 4Y5RC 2OK6D 2AGZD 3PXTC 2H47B 3ORVC 4FA9C 4FAVC 2HKMD 2AGWD 2AH0D 3L4OC 4L1QC 2AGYD 2GC4B 4FA4C 2I0RD 2IUPD 2IURD 1MG3B 2IAAB 3PXSC 2J55L 2I0SD 2OK4D 2AGXD 3RMZC 3SLEC 4FA1C 4FANC 3RLMC 4FB1C 4L3HC 2J56L 2OIZD 4K3IC 4L3GC 3C75L 2I0TD
chains in the Genus database with same CATH topology
2IUVD 2OJYD 2HJBD 2MADL 4O1QC 2BBKL 2HXCD 3SJLC 4FA5C 1MAFL 2J57K 3PXWC 2AH1D 2AGLD 3RN1C 3SVWC 3RN0C 3SWSC 2H3XB 2GC7B 2HKRD 2Q7QD 2MTAL 2IUQD 2HJ4D 1MAEL 1MG2B 1MDAL 3L4MC 3SXTC 4Y5RC 2OK6D 2AGZD 3PXTC 2H47B 3ORVC 4FA9C 4FAVC 2HKMD 2AGWD 2AH0D 3L4OC 4L1QC 2AGYD 2GC4B 4FA4C 2I0RD 2IUPD 2IURD 1MG3B 2IAAB 3PXSC 2J55L 2I0SD 2OK4D 2AGXD 3RMZC 3SLEC 4FA1C 4FANC 3RLMC 4FB1C 4L3HC 2J56L 2OIZD 4K3IC 4L3GC 3C75L 2I0TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUV D;  2OJY D;  2HJB D;  2MAD L;  4O1Q C;  2BBK L;  2HXC D;  3SJL C;  4FA5 C;  1MAF L;  2J57 K;  3PXW C;  2AH1 D;  2AGL D;  3RN1 C;  3SVW C;  3RN0 C;  3SWS C;  2H3X B;  2GC7 B;  2HKR D;  2Q7Q D;  2MTA L;  2IUQ D;  2HJ4 D;  1MAE L;  1MG2 B;  1MDA L;  3L4M C;  3SXT C;  4Y5R C;  2OK6 D;  2AGZ D;  3PXT C;  2H47 B;  3ORV C;  4FA9 C;  4FAV C;  2HKM D;  2AGW D;  2AH0 D;  3L4O C;  4L1Q C;  2AGY D;  2GC4 B;  4FA4 C;  2I0R D;  2IUP D;  2IUR D;  1MG3 B;  2IAA B;  3PXS C;  2J55 L;  2I0S D;  2OK4 D;  2AGX D;  3RMZ C;  3SLE C;  4FA1 C;  4FAN C;  3RLM C;  4FB1 C;  4L3H C;  2J56 L;  2OIZ D;  4K3I C;  4L3G C;  3C75 L;  2I0T D; 
#chains in the Genus database with same CATH topology
 2IUV D;  2OJY D;  2HJB D;  2MAD L;  4O1Q C;  2BBK L;  2HXC D;  3SJL C;  4FA5 C;  1MAF L;  2J57 K;  3PXW C;  2AH1 D;  2AGL D;  3RN1 C;  3SVW C;  3RN0 C;  3SWS C;  2H3X B;  2GC7 B;  2HKR D;  2Q7Q D;  2MTA L;  2IUQ D;  2HJ4 D;  1MAE L;  1MG2 B;  1MDA L;  3L4M C;  3SXT C;  4Y5R C;  2OK6 D;  2AGZ D;  3PXT C;  2H47 B;  3ORV C;  4FA9 C;  4FAV C;  2HKM D;  2AGW D;  2AH0 D;  3L4O C;  4L1Q C;  2AGY D;  2GC4 B;  4FA4 C;  2I0R D;  2IUP D;  2IUR D;  1MG3 B;  2IAA B;  3PXS C;  2J55 L;  2I0S D;  2OK4 D;  2AGX D;  3RMZ C;  3SLE C;  4FA1 C;  4FAN C;  3RLM C;  4FB1 C;  4L3H C;  2J56 L;  2OIZ D;  4K3I C;  4L3G C;  3C75 L;  2I0T D; 
#chains in the Genus database with same CATH homology
 2IUV D;  2OJY D;  2HJB D;  2MAD L;  4O1Q C;  2BBK L;  2HXC D;  3SJL C;  4FA5 C;  1MAF L;  2J57 K;  3PXW C;  2AH1 D;  2AGL D;  3RN1 C;  3SVW C;  3RN0 C;  3SWS C;  2H3X B;  2GC7 B;  2HKR D;  2Q7Q D;  2MTA L;  2IUQ D;  2HJ4 D;  1MAE L;  1MG2 B;  1MDA L;  3L4M C;  3SXT C;  4Y5R C;  2OK6 D;  2AGZ D;  3PXT C;  2H47 B;  3ORV C;  4FA9 C;  4FAV C;  2HKM D;  2AGW D;  2AH0 D;  3L4O C;  4L1Q C;  2AGY D;  2GC4 B;  4FA4 C;  2I0R D;  2IUP D;  2IUR D;  1MG3 B;  2IAA B;  3PXS C;  2J55 L;  2I0S D;  2OK4 D;  2AGX D;  3RMZ C;  3SLE C;  4FA1 C;  4FAN C;  3RLM C;  4FB1 C;  4L3H C;  2J56 L;  2OIZ D;  4K3I C;  4L3G C;  3C75 L;  2I0T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...