2OK4D

Crystal structure of aromatic amine dehydrogenase ttq-phenylacetaldehyde adduct oxidized with ferricyanide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ok4D00
2MADL 3RN0C 3SXTC 3PXSC 2AGZD 4Y5RC 2H47B 3SLEC 2MTAL 2I0TD 2J55L 2HKRD 2HXCD 2J56L 2Q7QD 4FA9C 2I0RD 2OK4D 3PXTC 2IAAB 2GC7B 2OJYD 2OK6D 3C75L 3L4MC 4O1QC 2IUPD 3RMZC 2H3XB 2HKMD 2IUVD 1MAEL 4L3GC 4FA5C 4K3IC 2AGLD 2AGXD 3PXWC 4L3HC 4L1QC 3SWSC 2HJ4D 4FANC 2I0SD 2BBKL 4FA4C 4FB1C 3RN1C 2GC4B 2IURD 3L4OC 3ORVC 2J57K 2HJBD 2AGWD 2AH1D 3SVWC 2OIZD 4FA1C 3RLMC 1MG3B 2AGYD 2IUQD 4FAVC 3SJLC 2AH0D 1MAFL 1MG2B 1MDAL
chains in the Genus database with same CATH superfamily
2MADL 3RN0C 3SXTC 3PXSC 2AGZD 4Y5RC 2H47B 3SLEC 2MTAL 2I0TD 2J55L 2HKRD 2HXCD 2J56L 2Q7QD 4FA9C 2I0RD 2OK4D 3PXTC 2IAAB 2GC7B 2OJYD 2OK6D 3C75L 3L4MC 4O1QC 2IUPD 3RMZC 2H3XB 2HKMD 2IUVD 1MAEL 4L3GC 4FA5C 4K3IC 2AGLD 2AGXD 3PXWC 4L3HC 4L1QC 3SWSC 2HJ4D 4FANC 2I0SD 2BBKL 4FA4C 4FB1C 3RN1C 2GC4B 2IURD 3L4OC 3ORVC 2J57K 2HJBD 2AGWD 2AH1D 3SVWC 2OIZD 4FA1C 3RLMC 1MG3B 2AGYD 2IUQD 4FAVC 3SJLC 2AH0D 1MAFL 1MG2B 1MDAL
chains in the Genus database with same CATH topology
2MADL 3RN0C 3SXTC 3PXSC 2AGZD 4Y5RC 2H47B 3SLEC 2MTAL 2I0TD 2J55L 2HKRD 2HXCD 2J56L 2Q7QD 4FA9C 2I0RD 2OK4D 3PXTC 2IAAB 2GC7B 2OJYD 2OK6D 3C75L 3L4MC 4O1QC 2IUPD 3RMZC 2H3XB 2HKMD 2IUVD 1MAEL 4L3GC 4FA5C 4K3IC 2AGLD 2AGXD 3PXWC 4L3HC 4L1QC 3SWSC 2HJ4D 4FANC 2I0SD 2BBKL 4FA4C 4FB1C 3RN1C 2GC4B 2IURD 3L4OC 3ORVC 2J57K 2HJBD 2AGWD 2AH1D 3SVWC 2OIZD 4FA1C 3RLMC 1MG3B 2AGYD 2IUQD 4FAVC 3SJLC 2AH0D 1MAFL 1MG2B 1MDAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAD L;  3RN0 C;  3SXT C;  3PXS C;  2AGZ D;  4Y5R C;  2H47 B;  3SLE C;  2MTA L;  2I0T D;  2J55 L;  2HKR D;  2HXC D;  2J56 L;  2Q7Q D;  4FA9 C;  2I0R D;  2OK4 D;  3PXT C;  2IAA B;  2GC7 B;  2OJY D;  2OK6 D;  3C75 L;  3L4M C;  4O1Q C;  2IUP D;  3RMZ C;  2H3X B;  2HKM D;  2IUV D;  1MAE L;  4L3G C;  4FA5 C;  4K3I C;  2AGL D;  2AGX D;  3PXW C;  4L3H C;  4L1Q C;  3SWS C;  2HJ4 D;  4FAN C;  2I0S D;  2BBK L;  4FA4 C;  4FB1 C;  3RN1 C;  2GC4 B;  2IUR D;  3L4O C;  3ORV C;  2J57 K;  2HJB D;  2AGW D;  2AH1 D;  3SVW C;  2OIZ D;  4FA1 C;  3RLM C;  1MG3 B;  2AGY D;  2IUQ D;  4FAV C;  3SJL C;  2AH0 D;  1MAF L;  1MG2 B;  1MDA L; 
#chains in the Genus database with same CATH topology
 2MAD L;  3RN0 C;  3SXT C;  3PXS C;  2AGZ D;  4Y5R C;  2H47 B;  3SLE C;  2MTA L;  2I0T D;  2J55 L;  2HKR D;  2HXC D;  2J56 L;  2Q7Q D;  4FA9 C;  2I0R D;  2OK4 D;  3PXT C;  2IAA B;  2GC7 B;  2OJY D;  2OK6 D;  3C75 L;  3L4M C;  4O1Q C;  2IUP D;  3RMZ C;  2H3X B;  2HKM D;  2IUV D;  1MAE L;  4L3G C;  4FA5 C;  4K3I C;  2AGL D;  2AGX D;  3PXW C;  4L3H C;  4L1Q C;  3SWS C;  2HJ4 D;  4FAN C;  2I0S D;  2BBK L;  4FA4 C;  4FB1 C;  3RN1 C;  2GC4 B;  2IUR D;  3L4O C;  3ORV C;  2J57 K;  2HJB D;  2AGW D;  2AH1 D;  3SVW C;  2OIZ D;  4FA1 C;  3RLM C;  1MG3 B;  2AGY D;  2IUQ D;  4FAV C;  3SJL C;  2AH0 D;  1MAF L;  1MG2 B;  1MDA L; 
#chains in the Genus database with same CATH homology
 2MAD L;  3RN0 C;  3SXT C;  3PXS C;  2AGZ D;  4Y5R C;  2H47 B;  3SLE C;  2MTA L;  2I0T D;  2J55 L;  2HKR D;  2HXC D;  2J56 L;  2Q7Q D;  4FA9 C;  2I0R D;  2OK4 D;  3PXT C;  2IAA B;  2GC7 B;  2OJY D;  2OK6 D;  3C75 L;  3L4M C;  4O1Q C;  2IUP D;  3RMZ C;  2H3X B;  2HKM D;  2IUV D;  1MAE L;  4L3G C;  4FA5 C;  4K3I C;  2AGL D;  2AGX D;  3PXW C;  4L3H C;  4L1Q C;  3SWS C;  2HJ4 D;  4FAN C;  2I0S D;  2BBK L;  4FA4 C;  4FB1 C;  3RN1 C;  2GC4 B;  2IUR D;  3L4O C;  3ORV C;  2J57 K;  2HJB D;  2AGW D;  2AH1 D;  3SVW C;  2OIZ D;  4FA1 C;  3RLM C;  1MG3 B;  2AGY D;  2IUQ D;  4FAV C;  3SJL C;  2AH0 D;  1MAF L;  1MG2 B;  1MDA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...