2H47B

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
124
structure length
123
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 123
sequence length 124
chains with identical sequence E, G, I
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2h47B00
4FA5C 3SLEC 2I0SD 2AGXD 2IAAB 2AGZD 4L1QC 1MAFL 2BBKL 2IURD 2AGWD 2HJ4D 3SJLC 2GC7B 2J57K 2IUPD 2HJBD 2OJYD 4K3IC 4L3HC 4FA1C 2HKRD 2AH0D 3RMZC 2GC4B 2I0RD 2J55L 2HXCD 2OK6D 2IUQD 3SVWC 1MG3B 1MAEL 2MTAL 4L3GC 4Y5RC 3PXWC 2J56L 2H47B 3SXTC 2OK4D 3L4MC 2AGYD 3C75L 4O1QC 2Q7QD 3RN1C 3L4OC 1MG2B 4FAVC 2MADL 3RN0C 3PXSC 3PXTC 3RLMC 2OIZD 4FA9C 3ORVC 2AH1D 2HKMD 2IUVD 2AGLD 3SWSC 4FA4C 4FB1C 1MDAL 4FANC 2H3XB 2I0TD
chains in the Genus database with same CATH superfamily
4FA5C 3SLEC 2I0SD 2AGXD 2IAAB 2AGZD 4L1QC 1MAFL 2BBKL 2IURD 2AGWD 2HJ4D 3SJLC 2GC7B 2J57K 2IUPD 2HJBD 2OJYD 4K3IC 4L3HC 4FA1C 2HKRD 2AH0D 3RMZC 2GC4B 2I0RD 2J55L 2HXCD 2OK6D 2IUQD 3SVWC 1MG3B 1MAEL 2MTAL 4L3GC 4Y5RC 3PXWC 2J56L 2H47B 3SXTC 2OK4D 3L4MC 2AGYD 3C75L 4O1QC 2Q7QD 3RN1C 3L4OC 1MG2B 4FAVC 2MADL 3RN0C 3PXSC 3PXTC 3RLMC 2OIZD 4FA9C 3ORVC 2AH1D 2HKMD 2IUVD 2AGLD 3SWSC 4FA4C 4FB1C 1MDAL 4FANC 2H3XB 2I0TD
chains in the Genus database with same CATH topology
4FA5C 3SLEC 2I0SD 2AGXD 2IAAB 2AGZD 4L1QC 1MAFL 2BBKL 2IURD 2AGWD 2HJ4D 3SJLC 2GC7B 2J57K 2IUPD 2HJBD 2OJYD 4K3IC 4L3HC 4FA1C 2HKRD 2AH0D 3RMZC 2GC4B 2I0RD 2J55L 2HXCD 2OK6D 2IUQD 3SVWC 1MG3B 1MAEL 2MTAL 4L3GC 4Y5RC 3PXWC 2J56L 2H47B 3SXTC 2OK4D 3L4MC 2AGYD 3C75L 4O1QC 2Q7QD 3RN1C 3L4OC 1MG2B 4FAVC 2MADL 3RN0C 3PXSC 3PXTC 3RLMC 2OIZD 4FA9C 3ORVC 2AH1D 2HKMD 2IUVD 2AGLD 3SWSC 4FA4C 4FB1C 1MDAL 4FANC 2H3XB 2I0TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA5 C;  3SLE C;  2I0S D;  2AGX D;  2IAA B;  2AGZ D;  4L1Q C;  1MAF L;  2BBK L;  2IUR D;  2AGW D;  2HJ4 D;  3SJL C;  2GC7 B;  2J57 K;  2IUP D;  2HJB D;  2OJY D;  4K3I C;  4L3H C;  4FA1 C;  2HKR D;  2AH0 D;  3RMZ C;  2GC4 B;  2I0R D;  2J55 L;  2HXC D;  2OK6 D;  2IUQ D;  3SVW C;  1MG3 B;  1MAE L;  2MTA L;  4L3G C;  4Y5R C;  3PXW C;  2J56 L;  2H47 B;  3SXT C;  2OK4 D;  3L4M C;  2AGY D;  3C75 L;  4O1Q C;  2Q7Q D;  3RN1 C;  3L4O C;  1MG2 B;  4FAV C;  2MAD L;  3RN0 C;  3PXS C;  3PXT C;  3RLM C;  2OIZ D;  4FA9 C;  3ORV C;  2AH1 D;  2HKM D;  2IUV D;  2AGL D;  3SWS C;  4FA4 C;  4FB1 C;  1MDA L;  4FAN C;  2H3X B;  2I0T D; 
#chains in the Genus database with same CATH topology
 4FA5 C;  3SLE C;  2I0S D;  2AGX D;  2IAA B;  2AGZ D;  4L1Q C;  1MAF L;  2BBK L;  2IUR D;  2AGW D;  2HJ4 D;  3SJL C;  2GC7 B;  2J57 K;  2IUP D;  2HJB D;  2OJY D;  4K3I C;  4L3H C;  4FA1 C;  2HKR D;  2AH0 D;  3RMZ C;  2GC4 B;  2I0R D;  2J55 L;  2HXC D;  2OK6 D;  2IUQ D;  3SVW C;  1MG3 B;  1MAE L;  2MTA L;  4L3G C;  4Y5R C;  3PXW C;  2J56 L;  2H47 B;  3SXT C;  2OK4 D;  3L4M C;  2AGY D;  3C75 L;  4O1Q C;  2Q7Q D;  3RN1 C;  3L4O C;  1MG2 B;  4FAV C;  2MAD L;  3RN0 C;  3PXS C;  3PXT C;  3RLM C;  2OIZ D;  4FA9 C;  3ORV C;  2AH1 D;  2HKM D;  2IUV D;  2AGL D;  3SWS C;  4FA4 C;  4FB1 C;  1MDA L;  4FAN C;  2H3X B;  2I0T D; 
#chains in the Genus database with same CATH homology
 4FA5 C;  3SLE C;  2I0S D;  2AGX D;  2IAA B;  2AGZ D;  4L1Q C;  1MAF L;  2BBK L;  2IUR D;  2AGW D;  2HJ4 D;  3SJL C;  2GC7 B;  2J57 K;  2IUP D;  2HJB D;  2OJY D;  4K3I C;  4L3H C;  4FA1 C;  2HKR D;  2AH0 D;  3RMZ C;  2GC4 B;  2I0R D;  2J55 L;  2HXC D;  2OK6 D;  2IUQ D;  3SVW C;  1MG3 B;  1MAE L;  2MTA L;  4L3G C;  4Y5R C;  3PXW C;  2J56 L;  2H47 B;  3SXT C;  2OK4 D;  3L4M C;  2AGY D;  3C75 L;  4O1Q C;  2Q7Q D;  3RN1 C;  3L4O C;  1MG2 B;  4FAV C;  2MAD L;  3RN0 C;  3PXS C;  3PXT C;  3RLM C;  2OIZ D;  4FA9 C;  3ORV C;  2AH1 D;  2HKM D;  2IUV D;  2AGL D;  3SWS C;  4FA4 C;  4FB1 C;  1MDA L;  4FAN C;  2H3X B;  2I0T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...