2H47B

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
124
structure length
123
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
total genus 30
structure length 123
sequence length 124
chains with identical sequence E, G, I
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2h47B00
1MG2B 3SLEC 2AGWD 2IAAB 2J55L 4FB1C 2GC7B 4K3IC 3SWSC 2I0TD 4FA5C 2BBKL 1MAEL 1MDAL 3RLMC 2I0SD 3SVWC 2HXCD 2IUQD 3RN0C 3RMZC 3PXTC 3L4OC 2AH1D 2HKRD 2H3XB 3PXWC 2OIZD 1MG3B 4O1QC 2OJYD 2H47B 2IUPD 2IUVD 2HJ4D 3L4MC 1MAFL 3PXSC 4L1QC 2AGXD 4L3HC 4Y5RC 2J57K 2GC4B 2Q7QD 2OK6D 2HJBD 3C75L 2J56L 2MTAL 2AGLD 2IURD 3ORVC 2OK4D 4FAVC 3RN1C 2AH0D 2AGZD 3SXTC 4FA4C 2HKMD 2I0RD 2MADL 3SJLC 4FA9C 4L3GC 4FANC 4FA1C 2AGYD
chains in the Genus database with same CATH superfamily
1MG2B 3SLEC 2AGWD 2IAAB 2J55L 4FB1C 2GC7B 4K3IC 3SWSC 2I0TD 4FA5C 2BBKL 1MAEL 1MDAL 3RLMC 2I0SD 3SVWC 2HXCD 2IUQD 3RN0C 3RMZC 3PXTC 3L4OC 2AH1D 2HKRD 2H3XB 3PXWC 2OIZD 1MG3B 4O1QC 2OJYD 2H47B 2IUPD 2IUVD 2HJ4D 3L4MC 1MAFL 3PXSC 4L1QC 2AGXD 4L3HC 4Y5RC 2J57K 2GC4B 2Q7QD 2OK6D 2HJBD 3C75L 2J56L 2MTAL 2AGLD 2IURD 3ORVC 2OK4D 4FAVC 3RN1C 2AH0D 2AGZD 3SXTC 4FA4C 2HKMD 2I0RD 2MADL 3SJLC 4FA9C 4L3GC 4FANC 4FA1C 2AGYD
chains in the Genus database with same CATH topology
1MG2B 3SLEC 2AGWD 2IAAB 2J55L 4FB1C 2GC7B 4K3IC 3SWSC 2I0TD 4FA5C 2BBKL 1MAEL 1MDAL 3RLMC 2I0SD 3SVWC 2HXCD 2IUQD 3RN0C 3RMZC 3PXTC 3L4OC 2AH1D 2HKRD 2H3XB 3PXWC 2OIZD 1MG3B 4O1QC 2OJYD 2H47B 2IUPD 2IUVD 2HJ4D 3L4MC 1MAFL 3PXSC 4L1QC 2AGXD 4L3HC 4Y5RC 2J57K 2GC4B 2Q7QD 2OK6D 2HJBD 3C75L 2J56L 2MTAL 2AGLD 2IURD 3ORVC 2OK4D 4FAVC 3RN1C 2AH0D 2AGZD 3SXTC 4FA4C 2HKMD 2I0RD 2MADL 3SJLC 4FA9C 4L3GC 4FANC 4FA1C 2AGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG2 B;  3SLE C;  2AGW D;  2IAA B;  2J55 L;  4FB1 C;  2GC7 B;  4K3I C;  3SWS C;  2I0T D;  4FA5 C;  2BBK L;  1MAE L;  1MDA L;  3RLM C;  2I0S D;  3SVW C;  2HXC D;  2IUQ D;  3RN0 C;  3RMZ C;  3PXT C;  3L4O C;  2AH1 D;  2HKR D;  2H3X B;  3PXW C;  2OIZ D;  1MG3 B;  4O1Q C;  2OJY D;  2H47 B;  2IUP D;  2IUV D;  2HJ4 D;  3L4M C;  1MAF L;  3PXS C;  4L1Q C;  2AGX D;  4L3H C;  4Y5R C;  2J57 K;  2GC4 B;  2Q7Q D;  2OK6 D;  2HJB D;  3C75 L;  2J56 L;  2MTA L;  2AGL D;  2IUR D;  3ORV C;  2OK4 D;  4FAV C;  3RN1 C;  2AH0 D;  2AGZ D;  3SXT C;  4FA4 C;  2HKM D;  2I0R D;  2MAD L;  3SJL C;  4FA9 C;  4L3G C;  4FAN C;  4FA1 C;  2AGY D; 
#chains in the Genus database with same CATH topology
 1MG2 B;  3SLE C;  2AGW D;  2IAA B;  2J55 L;  4FB1 C;  2GC7 B;  4K3I C;  3SWS C;  2I0T D;  4FA5 C;  2BBK L;  1MAE L;  1MDA L;  3RLM C;  2I0S D;  3SVW C;  2HXC D;  2IUQ D;  3RN0 C;  3RMZ C;  3PXT C;  3L4O C;  2AH1 D;  2HKR D;  2H3X B;  3PXW C;  2OIZ D;  1MG3 B;  4O1Q C;  2OJY D;  2H47 B;  2IUP D;  2IUV D;  2HJ4 D;  3L4M C;  1MAF L;  3PXS C;  4L1Q C;  2AGX D;  4L3H C;  4Y5R C;  2J57 K;  2GC4 B;  2Q7Q D;  2OK6 D;  2HJB D;  3C75 L;  2J56 L;  2MTA L;  2AGL D;  2IUR D;  3ORV C;  2OK4 D;  4FAV C;  3RN1 C;  2AH0 D;  2AGZ D;  3SXT C;  4FA4 C;  2HKM D;  2I0R D;  2MAD L;  3SJL C;  4FA9 C;  4L3G C;  4FAN C;  4FA1 C;  2AGY D; 
#chains in the Genus database with same CATH homology
 1MG2 B;  3SLE C;  2AGW D;  2IAA B;  2J55 L;  4FB1 C;  2GC7 B;  4K3I C;  3SWS C;  2I0T D;  4FA5 C;  2BBK L;  1MAE L;  1MDA L;  3RLM C;  2I0S D;  3SVW C;  2HXC D;  2IUQ D;  3RN0 C;  3RMZ C;  3PXT C;  3L4O C;  2AH1 D;  2HKR D;  2H3X B;  3PXW C;  2OIZ D;  1MG3 B;  4O1Q C;  2OJY D;  2H47 B;  2IUP D;  2IUV D;  2HJ4 D;  3L4M C;  1MAF L;  3PXS C;  4L1Q C;  2AGX D;  4L3H C;  4Y5R C;  2J57 K;  2GC4 B;  2Q7Q D;  2OK6 D;  2HJB D;  3C75 L;  2J56 L;  2MTA L;  2AGL D;  2IUR D;  3ORV C;  2OK4 D;  4FAV C;  3RN1 C;  2AH0 D;  2AGZ D;  3SXT C;  4FA4 C;  2HKM D;  2I0R D;  2MAD L;  3SJL C;  4FA9 C;  4L3G C;  4FAN C;  4FA1 C;  2AGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...