2IUPD

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iupD00
2IAAB 2HXCD 2J55L 2OK6D 3C75L 2H3XB 2I0TD 4FA5C 2Q7QD 2MADL 2MTAL 3ORVC 4FA4C 2AGZD 1MG3B 1MDAL 2HJBD 3L4OC 4O1QC 3PXTC 3SXTC 3SLEC 2AGYD 2HKRD 3RLMC 2AH0D 2OIZD 2IURD 4FB1C 3SVWC 2IUVD 4K3IC 3RN0C 3SWSC 3PXWC 1MG2B 2IUPD 4FANC 3SJLC 4Y5RC 2HJ4D 2AGWD 2OK4D 2I0RD 4L3HC 3RMZC 1MAFL 2AGLD 2J56L 1MAEL 4L1QC 2GC4B 2IUQD 2AGXD 3RN1C 2OJYD 4FA1C 2BBKL 4FA9C 4L3GC 2AH1D 2I0SD 3L4MC 3PXSC 2H47B 4FAVC 2J57K 2HKMD 2GC7B
chains in the Genus database with same CATH superfamily
2IAAB 2HXCD 2J55L 2OK6D 3C75L 2H3XB 2I0TD 4FA5C 2Q7QD 2MADL 2MTAL 3ORVC 4FA4C 2AGZD 1MG3B 1MDAL 2HJBD 3L4OC 4O1QC 3PXTC 3SXTC 3SLEC 2AGYD 2HKRD 3RLMC 2AH0D 2OIZD 2IURD 4FB1C 3SVWC 2IUVD 4K3IC 3RN0C 3SWSC 3PXWC 1MG2B 2IUPD 4FANC 3SJLC 4Y5RC 2HJ4D 2AGWD 2OK4D 2I0RD 4L3HC 3RMZC 1MAFL 2AGLD 2J56L 1MAEL 4L1QC 2GC4B 2IUQD 2AGXD 3RN1C 2OJYD 4FA1C 2BBKL 4FA9C 4L3GC 2AH1D 2I0SD 3L4MC 3PXSC 2H47B 4FAVC 2J57K 2HKMD 2GC7B
chains in the Genus database with same CATH topology
2IAAB 2HXCD 2J55L 2OK6D 3C75L 2H3XB 2I0TD 4FA5C 2Q7QD 2MADL 2MTAL 3ORVC 4FA4C 2AGZD 1MG3B 1MDAL 2HJBD 3L4OC 4O1QC 3PXTC 3SXTC 3SLEC 2AGYD 2HKRD 3RLMC 2AH0D 2OIZD 2IURD 4FB1C 3SVWC 2IUVD 4K3IC 3RN0C 3SWSC 3PXWC 1MG2B 2IUPD 4FANC 3SJLC 4Y5RC 2HJ4D 2AGWD 2OK4D 2I0RD 4L3HC 3RMZC 1MAFL 2AGLD 2J56L 1MAEL 4L1QC 2GC4B 2IUQD 2AGXD 3RN1C 2OJYD 4FA1C 2BBKL 4FA9C 4L3GC 2AH1D 2I0SD 3L4MC 3PXSC 2H47B 4FAVC 2J57K 2HKMD 2GC7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAA B;  2HXC D;  2J55 L;  2OK6 D;  3C75 L;  2H3X B;  2I0T D;  4FA5 C;  2Q7Q D;  2MAD L;  2MTA L;  3ORV C;  4FA4 C;  2AGZ D;  1MG3 B;  1MDA L;  2HJB D;  3L4O C;  4O1Q C;  3PXT C;  3SXT C;  3SLE C;  2AGY D;  2HKR D;  3RLM C;  2AH0 D;  2OIZ D;  2IUR D;  4FB1 C;  3SVW C;  2IUV D;  4K3I C;  3RN0 C;  3SWS C;  3PXW C;  1MG2 B;  2IUP D;  4FAN C;  3SJL C;  4Y5R C;  2HJ4 D;  2AGW D;  2OK4 D;  2I0R D;  4L3H C;  3RMZ C;  1MAF L;  2AGL D;  2J56 L;  1MAE L;  4L1Q C;  2GC4 B;  2IUQ D;  2AGX D;  3RN1 C;  2OJY D;  4FA1 C;  2BBK L;  4FA9 C;  4L3G C;  2AH1 D;  2I0S D;  3L4M C;  3PXS C;  2H47 B;  4FAV C;  2J57 K;  2HKM D;  2GC7 B; 
#chains in the Genus database with same CATH topology
 2IAA B;  2HXC D;  2J55 L;  2OK6 D;  3C75 L;  2H3X B;  2I0T D;  4FA5 C;  2Q7Q D;  2MAD L;  2MTA L;  3ORV C;  4FA4 C;  2AGZ D;  1MG3 B;  1MDA L;  2HJB D;  3L4O C;  4O1Q C;  3PXT C;  3SXT C;  3SLE C;  2AGY D;  2HKR D;  3RLM C;  2AH0 D;  2OIZ D;  2IUR D;  4FB1 C;  3SVW C;  2IUV D;  4K3I C;  3RN0 C;  3SWS C;  3PXW C;  1MG2 B;  2IUP D;  4FAN C;  3SJL C;  4Y5R C;  2HJ4 D;  2AGW D;  2OK4 D;  2I0R D;  4L3H C;  3RMZ C;  1MAF L;  2AGL D;  2J56 L;  1MAE L;  4L1Q C;  2GC4 B;  2IUQ D;  2AGX D;  3RN1 C;  2OJY D;  4FA1 C;  2BBK L;  4FA9 C;  4L3G C;  2AH1 D;  2I0S D;  3L4M C;  3PXS C;  2H47 B;  4FAV C;  2J57 K;  2HKM D;  2GC7 B; 
#chains in the Genus database with same CATH homology
 2IAA B;  2HXC D;  2J55 L;  2OK6 D;  3C75 L;  2H3X B;  2I0T D;  4FA5 C;  2Q7Q D;  2MAD L;  2MTA L;  3ORV C;  4FA4 C;  2AGZ D;  1MG3 B;  1MDA L;  2HJB D;  3L4O C;  4O1Q C;  3PXT C;  3SXT C;  3SLE C;  2AGY D;  2HKR D;  3RLM C;  2AH0 D;  2OIZ D;  2IUR D;  4FB1 C;  3SVW C;  2IUV D;  4K3I C;  3RN0 C;  3SWS C;  3PXW C;  1MG2 B;  2IUP D;  4FAN C;  3SJL C;  4Y5R C;  2HJ4 D;  2AGW D;  2OK4 D;  2I0R D;  4L3H C;  3RMZ C;  1MAF L;  2AGL D;  2J56 L;  1MAE L;  4L1Q C;  2GC4 B;  2IUQ D;  2AGX D;  3RN1 C;  2OJY D;  4FA1 C;  2BBK L;  4FA9 C;  4L3G C;  2AH1 D;  2I0S D;  3L4M C;  3PXS C;  2H47 B;  4FAV C;  2J57 K;  2HKM D;  2GC7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...