2IUPD

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 26
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iupD00
2I0SD 2HJBD 2AH0D 1MDAL 4O1QC 3SXTC 3ORVC 2IUPD 3RN0C 3SLEC 2I0RD 2OK4D 3PXWC 3RMZC 2GC7B 3SWSC 2AGLD 2BBKL 4FA9C 2Q7QD 2AH1D 4FAVC 2AGWD 4K3IC 2MADL 3SJLC 3SVWC 2J57K 2MTAL 4Y5RC 4FB1C 2OIZD 3C75L 2AGYD 2IURD 3L4OC 3L4MC 2GC4B 2H47B 2AGXD 1MAFL 3PXTC 4L1QC 4FA4C 2IUVD 1MAEL 3RLMC 2HKRD 4L3HC 2HKMD 2HJ4D 2HXCD 3PXSC 2OJYD 2H3XB 2J56L 1MG2B 4FANC 2AGZD 3RN1C 1MG3B 2I0TD 2IUQD 4FA5C 2IAAB 2OK6D 2J55L 4L3GC 4FA1C
chains in the Genus database with same CATH superfamily
2I0SD 2HJBD 2AH0D 1MDAL 4O1QC 3SXTC 3ORVC 2IUPD 3RN0C 3SLEC 2I0RD 2OK4D 3PXWC 3RMZC 2GC7B 3SWSC 2AGLD 2BBKL 4FA9C 2Q7QD 2AH1D 4FAVC 2AGWD 4K3IC 2MADL 3SJLC 3SVWC 2J57K 2MTAL 4Y5RC 4FB1C 2OIZD 3C75L 2AGYD 2IURD 3L4OC 3L4MC 2GC4B 2H47B 2AGXD 1MAFL 3PXTC 4L1QC 4FA4C 2IUVD 1MAEL 3RLMC 2HKRD 4L3HC 2HKMD 2HJ4D 2HXCD 3PXSC 2OJYD 2H3XB 2J56L 1MG2B 4FANC 2AGZD 3RN1C 1MG3B 2I0TD 2IUQD 4FA5C 2IAAB 2OK6D 2J55L 4L3GC 4FA1C
chains in the Genus database with same CATH topology
2I0SD 2HJBD 2AH0D 1MDAL 4O1QC 3SXTC 3ORVC 2IUPD 3RN0C 3SLEC 2I0RD 2OK4D 3PXWC 3RMZC 2GC7B 3SWSC 2AGLD 2BBKL 4FA9C 2Q7QD 2AH1D 4FAVC 2AGWD 4K3IC 2MADL 3SJLC 3SVWC 2J57K 2MTAL 4Y5RC 4FB1C 2OIZD 3C75L 2AGYD 2IURD 3L4OC 3L4MC 2GC4B 2H47B 2AGXD 1MAFL 3PXTC 4L1QC 4FA4C 2IUVD 1MAEL 3RLMC 2HKRD 4L3HC 2HKMD 2HJ4D 2HXCD 3PXSC 2OJYD 2H3XB 2J56L 1MG2B 4FANC 2AGZD 3RN1C 1MG3B 2I0TD 2IUQD 4FA5C 2IAAB 2OK6D 2J55L 4L3GC 4FA1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0S D;  2HJB D;  2AH0 D;  1MDA L;  4O1Q C;  3SXT C;  3ORV C;  2IUP D;  3RN0 C;  3SLE C;  2I0R D;  2OK4 D;  3PXW C;  3RMZ C;  2GC7 B;  3SWS C;  2AGL D;  2BBK L;  4FA9 C;  2Q7Q D;  2AH1 D;  4FAV C;  2AGW D;  4K3I C;  2MAD L;  3SJL C;  3SVW C;  2J57 K;  2MTA L;  4Y5R C;  4FB1 C;  2OIZ D;  3C75 L;  2AGY D;  2IUR D;  3L4O C;  3L4M C;  2GC4 B;  2H47 B;  2AGX D;  1MAF L;  3PXT C;  4L1Q C;  4FA4 C;  2IUV D;  1MAE L;  3RLM C;  2HKR D;  4L3H C;  2HKM D;  2HJ4 D;  2HXC D;  3PXS C;  2OJY D;  2H3X B;  2J56 L;  1MG2 B;  4FAN C;  2AGZ D;  3RN1 C;  1MG3 B;  2I0T D;  2IUQ D;  4FA5 C;  2IAA B;  2OK6 D;  2J55 L;  4L3G C;  4FA1 C; 
#chains in the Genus database with same CATH topology
 2I0S D;  2HJB D;  2AH0 D;  1MDA L;  4O1Q C;  3SXT C;  3ORV C;  2IUP D;  3RN0 C;  3SLE C;  2I0R D;  2OK4 D;  3PXW C;  3RMZ C;  2GC7 B;  3SWS C;  2AGL D;  2BBK L;  4FA9 C;  2Q7Q D;  2AH1 D;  4FAV C;  2AGW D;  4K3I C;  2MAD L;  3SJL C;  3SVW C;  2J57 K;  2MTA L;  4Y5R C;  4FB1 C;  2OIZ D;  3C75 L;  2AGY D;  2IUR D;  3L4O C;  3L4M C;  2GC4 B;  2H47 B;  2AGX D;  1MAF L;  3PXT C;  4L1Q C;  4FA4 C;  2IUV D;  1MAE L;  3RLM C;  2HKR D;  4L3H C;  2HKM D;  2HJ4 D;  2HXC D;  3PXS C;  2OJY D;  2H3X B;  2J56 L;  1MG2 B;  4FAN C;  2AGZ D;  3RN1 C;  1MG3 B;  2I0T D;  2IUQ D;  4FA5 C;  2IAA B;  2OK6 D;  2J55 L;  4L3G C;  4FA1 C; 
#chains in the Genus database with same CATH homology
 2I0S D;  2HJB D;  2AH0 D;  1MDA L;  4O1Q C;  3SXT C;  3ORV C;  2IUP D;  3RN0 C;  3SLE C;  2I0R D;  2OK4 D;  3PXW C;  3RMZ C;  2GC7 B;  3SWS C;  2AGL D;  2BBK L;  4FA9 C;  2Q7Q D;  2AH1 D;  4FAV C;  2AGW D;  4K3I C;  2MAD L;  3SJL C;  3SVW C;  2J57 K;  2MTA L;  4Y5R C;  4FB1 C;  2OIZ D;  3C75 L;  2AGY D;  2IUR D;  3L4O C;  3L4M C;  2GC4 B;  2H47 B;  2AGX D;  1MAF L;  3PXT C;  4L1Q C;  4FA4 C;  2IUV D;  1MAE L;  3RLM C;  2HKR D;  4L3H C;  2HKM D;  2HJ4 D;  2HXC D;  3PXS C;  2OJY D;  2H3X B;  2J56 L;  1MG2 B;  4FAN C;  2AGZ D;  3RN1 C;  1MG3 B;  2I0T D;  2IUQ D;  4FA5 C;  2IAA B;  2OK6 D;  2J55 L;  4L3G C;  4FA1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...