2HKRD

Structures of the carbinolamine and schiff-base intermediates in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with p-methoxyphenylethylamine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
source organism Alcaligenes faecalis
total genus 27
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hkrD00
4FANC 3ORVC 4FB1C 2HJ4D 2OIZD 4FA1C 2AGZD 2IAAB 2OJYD 1MG2B 4FA9C 2IUQD 4O1QC 4K3IC 4FA4C 2OK4D 4FA5C 1MDAL 3PXWC 3SLEC 2BBKL 1MG3B 2HXCD 3RLMC 1MAFL 3RMZC 2J57K 2H3XB 2MADL 3PXTC 3SJLC 4L3HC 4FAVC 2HKRD 3SWSC 2GC4B 2HKMD 3C75L 2J55L 2GC7B 2AH1D 2MTAL 3RN1C 2IUPD 3L4OC 2AGLD 2AGXD 1MAEL 3PXSC 3L4MC 2HJBD 3SVWC 4Y5RC 2I0SD 2I0RD 2IUVD 2OK6D 3RN0C 3SXTC 2AGWD 2I0TD 2Q7QD 4L3GC 4L1QC 2IURD 2J56L 2H47B 2AH0D 2AGYD
chains in the Genus database with same CATH superfamily
4FANC 3ORVC 4FB1C 2HJ4D 2OIZD 4FA1C 2AGZD 2IAAB 2OJYD 1MG2B 4FA9C 2IUQD 4O1QC 4K3IC 4FA4C 2OK4D 4FA5C 1MDAL 3PXWC 3SLEC 2BBKL 1MG3B 2HXCD 3RLMC 1MAFL 3RMZC 2J57K 2H3XB 2MADL 3PXTC 3SJLC 4L3HC 4FAVC 2HKRD 3SWSC 2GC4B 2HKMD 3C75L 2J55L 2GC7B 2AH1D 2MTAL 3RN1C 2IUPD 3L4OC 2AGLD 2AGXD 1MAEL 3PXSC 3L4MC 2HJBD 3SVWC 4Y5RC 2I0SD 2I0RD 2IUVD 2OK6D 3RN0C 3SXTC 2AGWD 2I0TD 2Q7QD 4L3GC 4L1QC 2IURD 2J56L 2H47B 2AH0D 2AGYD
chains in the Genus database with same CATH topology
4FANC 3ORVC 4FB1C 2HJ4D 2OIZD 4FA1C 2AGZD 2IAAB 2OJYD 1MG2B 4FA9C 2IUQD 4O1QC 4K3IC 4FA4C 2OK4D 4FA5C 1MDAL 3PXWC 3SLEC 2BBKL 1MG3B 2HXCD 3RLMC 1MAFL 3RMZC 2J57K 2H3XB 2MADL 3PXTC 3SJLC 4L3HC 4FAVC 2HKRD 3SWSC 2GC4B 2HKMD 3C75L 2J55L 2GC7B 2AH1D 2MTAL 3RN1C 2IUPD 3L4OC 2AGLD 2AGXD 1MAEL 3PXSC 3L4MC 2HJBD 3SVWC 4Y5RC 2I0SD 2I0RD 2IUVD 2OK6D 3RN0C 3SXTC 2AGWD 2I0TD 2Q7QD 4L3GC 4L1QC 2IURD 2J56L 2H47B 2AH0D 2AGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAN C;  3ORV C;  4FB1 C;  2HJ4 D;  2OIZ D;  4FA1 C;  2AGZ D;  2IAA B;  2OJY D;  1MG2 B;  4FA9 C;  2IUQ D;  4O1Q C;  4K3I C;  4FA4 C;  2OK4 D;  4FA5 C;  1MDA L;  3PXW C;  3SLE C;  2BBK L;  1MG3 B;  2HXC D;  3RLM C;  1MAF L;  3RMZ C;  2J57 K;  2H3X B;  2MAD L;  3PXT C;  3SJL C;  4L3H C;  4FAV C;  2HKR D;  3SWS C;  2GC4 B;  2HKM D;  3C75 L;  2J55 L;  2GC7 B;  2AH1 D;  2MTA L;  3RN1 C;  2IUP D;  3L4O C;  2AGL D;  2AGX D;  1MAE L;  3PXS C;  3L4M C;  2HJB D;  3SVW C;  4Y5R C;  2I0S D;  2I0R D;  2IUV D;  2OK6 D;  3RN0 C;  3SXT C;  2AGW D;  2I0T D;  2Q7Q D;  4L3G C;  4L1Q C;  2IUR D;  2J56 L;  2H47 B;  2AH0 D;  2AGY D; 
#chains in the Genus database with same CATH topology
 4FAN C;  3ORV C;  4FB1 C;  2HJ4 D;  2OIZ D;  4FA1 C;  2AGZ D;  2IAA B;  2OJY D;  1MG2 B;  4FA9 C;  2IUQ D;  4O1Q C;  4K3I C;  4FA4 C;  2OK4 D;  4FA5 C;  1MDA L;  3PXW C;  3SLE C;  2BBK L;  1MG3 B;  2HXC D;  3RLM C;  1MAF L;  3RMZ C;  2J57 K;  2H3X B;  2MAD L;  3PXT C;  3SJL C;  4L3H C;  4FAV C;  2HKR D;  3SWS C;  2GC4 B;  2HKM D;  3C75 L;  2J55 L;  2GC7 B;  2AH1 D;  2MTA L;  3RN1 C;  2IUP D;  3L4O C;  2AGL D;  2AGX D;  1MAE L;  3PXS C;  3L4M C;  2HJB D;  3SVW C;  4Y5R C;  2I0S D;  2I0R D;  2IUV D;  2OK6 D;  3RN0 C;  3SXT C;  2AGW D;  2I0T D;  2Q7Q D;  4L3G C;  4L1Q C;  2IUR D;  2J56 L;  2H47 B;  2AH0 D;  2AGY D; 
#chains in the Genus database with same CATH homology
 4FAN C;  3ORV C;  4FB1 C;  2HJ4 D;  2OIZ D;  4FA1 C;  2AGZ D;  2IAA B;  2OJY D;  1MG2 B;  4FA9 C;  2IUQ D;  4O1Q C;  4K3I C;  4FA4 C;  2OK4 D;  4FA5 C;  1MDA L;  3PXW C;  3SLE C;  2BBK L;  1MG3 B;  2HXC D;  3RLM C;  1MAF L;  3RMZ C;  2J57 K;  2H3X B;  2MAD L;  3PXT C;  3SJL C;  4L3H C;  4FAV C;  2HKR D;  3SWS C;  2GC4 B;  2HKM D;  3C75 L;  2J55 L;  2GC7 B;  2AH1 D;  2MTA L;  3RN1 C;  2IUP D;  3L4O C;  2AGL D;  2AGX D;  1MAE L;  3PXS C;  3L4M C;  2HJB D;  3SVW C;  4Y5R C;  2I0S D;  2I0R D;  2IUV D;  2OK6 D;  3RN0 C;  3SXT C;  2AGW D;  2I0T D;  2Q7Q D;  4L3G C;  4L1Q C;  2IUR D;  2J56 L;  2H47 B;  2AH0 D;  2AGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...