2HKRD

Structures of the carbinolamine and schiff-base intermediates in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with p-methoxyphenylethylamine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 27
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hkrD00
2GC4B 2MADL 2BBKL 2OJYD 1MAFL 2J56L 3RN1C 2AGXD 3RMZC 3RLMC 2IURD 4FANC 2H47B 2HJBD 4L3GC 2IUVD 2AH1D 2HKRD 4FA5C 2AGZD 2HKMD 1MG2B 2I0RD 2OK6D 4O1QC 2J57K 3RN0C 3L4OC 4FA4C 2OIZD 3ORVC 2AGYD 1MAEL 2HXCD 4Y5RC 2GC7B 2HJ4D 2AGLD 3PXSC 3PXTC 4FAVC 3SWSC 2IAAB 3L4MC 2Q7QD 2MTAL 2OK4D 4K3IC 4L1QC 1MG3B 2AH0D 2IUPD 2IUQD 3SVWC 2J55L 4FA1C 3PXWC 3SXTC 2I0TD 4FB1C 2I0SD 4FA9C 3C75L 2H3XB 3SLEC 3SJLC 2AGWD 4L3HC 1MDAL
chains in the Genus database with same CATH superfamily
2GC4B 2MADL 2BBKL 2OJYD 1MAFL 2J56L 3RN1C 2AGXD 3RMZC 3RLMC 2IURD 4FANC 2H47B 2HJBD 4L3GC 2IUVD 2AH1D 2HKRD 4FA5C 2AGZD 2HKMD 1MG2B 2I0RD 2OK6D 4O1QC 2J57K 3RN0C 3L4OC 4FA4C 2OIZD 3ORVC 2AGYD 1MAEL 2HXCD 4Y5RC 2GC7B 2HJ4D 2AGLD 3PXSC 3PXTC 4FAVC 3SWSC 2IAAB 3L4MC 2Q7QD 2MTAL 2OK4D 4K3IC 4L1QC 1MG3B 2AH0D 2IUPD 2IUQD 3SVWC 2J55L 4FA1C 3PXWC 3SXTC 2I0TD 4FB1C 2I0SD 4FA9C 3C75L 2H3XB 3SLEC 3SJLC 2AGWD 4L3HC 1MDAL
chains in the Genus database with same CATH topology
2GC4B 2MADL 2BBKL 2OJYD 1MAFL 2J56L 3RN1C 2AGXD 3RMZC 3RLMC 2IURD 4FANC 2H47B 2HJBD 4L3GC 2IUVD 2AH1D 2HKRD 4FA5C 2AGZD 2HKMD 1MG2B 2I0RD 2OK6D 4O1QC 2J57K 3RN0C 3L4OC 4FA4C 2OIZD 3ORVC 2AGYD 1MAEL 2HXCD 4Y5RC 2GC7B 2HJ4D 2AGLD 3PXSC 3PXTC 4FAVC 3SWSC 2IAAB 3L4MC 2Q7QD 2MTAL 2OK4D 4K3IC 4L1QC 1MG3B 2AH0D 2IUPD 2IUQD 3SVWC 2J55L 4FA1C 3PXWC 3SXTC 2I0TD 4FB1C 2I0SD 4FA9C 3C75L 2H3XB 3SLEC 3SJLC 2AGWD 4L3HC 1MDAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GC4 B;  2MAD L;  2BBK L;  2OJY D;  1MAF L;  2J56 L;  3RN1 C;  2AGX D;  3RMZ C;  3RLM C;  2IUR D;  4FAN C;  2H47 B;  2HJB D;  4L3G C;  2IUV D;  2AH1 D;  2HKR D;  4FA5 C;  2AGZ D;  2HKM D;  1MG2 B;  2I0R D;  2OK6 D;  4O1Q C;  2J57 K;  3RN0 C;  3L4O C;  4FA4 C;  2OIZ D;  3ORV C;  2AGY D;  1MAE L;  2HXC D;  4Y5R C;  2GC7 B;  2HJ4 D;  2AGL D;  3PXS C;  3PXT C;  4FAV C;  3SWS C;  2IAA B;  3L4M C;  2Q7Q D;  2MTA L;  2OK4 D;  4K3I C;  4L1Q C;  1MG3 B;  2AH0 D;  2IUP D;  2IUQ D;  3SVW C;  2J55 L;  4FA1 C;  3PXW C;  3SXT C;  2I0T D;  4FB1 C;  2I0S D;  4FA9 C;  3C75 L;  2H3X B;  3SLE C;  3SJL C;  2AGW D;  4L3H C;  1MDA L; 
#chains in the Genus database with same CATH topology
 2GC4 B;  2MAD L;  2BBK L;  2OJY D;  1MAF L;  2J56 L;  3RN1 C;  2AGX D;  3RMZ C;  3RLM C;  2IUR D;  4FAN C;  2H47 B;  2HJB D;  4L3G C;  2IUV D;  2AH1 D;  2HKR D;  4FA5 C;  2AGZ D;  2HKM D;  1MG2 B;  2I0R D;  2OK6 D;  4O1Q C;  2J57 K;  3RN0 C;  3L4O C;  4FA4 C;  2OIZ D;  3ORV C;  2AGY D;  1MAE L;  2HXC D;  4Y5R C;  2GC7 B;  2HJ4 D;  2AGL D;  3PXS C;  3PXT C;  4FAV C;  3SWS C;  2IAA B;  3L4M C;  2Q7Q D;  2MTA L;  2OK4 D;  4K3I C;  4L1Q C;  1MG3 B;  2AH0 D;  2IUP D;  2IUQ D;  3SVW C;  2J55 L;  4FA1 C;  3PXW C;  3SXT C;  2I0T D;  4FB1 C;  2I0S D;  4FA9 C;  3C75 L;  2H3X B;  3SLE C;  3SJL C;  2AGW D;  4L3H C;  1MDA L; 
#chains in the Genus database with same CATH homology
 2GC4 B;  2MAD L;  2BBK L;  2OJY D;  1MAF L;  2J56 L;  3RN1 C;  2AGX D;  3RMZ C;  3RLM C;  2IUR D;  4FAN C;  2H47 B;  2HJB D;  4L3G C;  2IUV D;  2AH1 D;  2HKR D;  4FA5 C;  2AGZ D;  2HKM D;  1MG2 B;  2I0R D;  2OK6 D;  4O1Q C;  2J57 K;  3RN0 C;  3L4O C;  4FA4 C;  2OIZ D;  3ORV C;  2AGY D;  1MAE L;  2HXC D;  4Y5R C;  2GC7 B;  2HJ4 D;  2AGL D;  3PXS C;  3PXT C;  4FAV C;  3SWS C;  2IAA B;  3L4M C;  2Q7Q D;  2MTA L;  2OK4 D;  4K3I C;  4L1Q C;  1MG3 B;  2AH0 D;  2IUP D;  2IUQ D;  3SVW C;  2J55 L;  4FA1 C;  3PXW C;  3SXT C;  2I0T D;  4FB1 C;  2I0S D;  4FA9 C;  3C75 L;  2H3X B;  3SLE C;  3SJL C;  2AGW D;  4L3H C;  1MDA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...