2HXCD

Crystal structure of the benzylamine complex of aromatic amine dehydrogenase in n-semiquinone form
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
110
structure length
109
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 29
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hxcD00
2H3XB 4FA4C 2AH0D 2HXCD 3SLEC 2GC7B 2AGXD 2HJ4D 3L4MC 4L3HC 3RMZC 4L1QC 2MTAL 4FANC 2HJBD 2IUQD 2OJYD 4K3IC 4FAVC 3PXWC 1MAFL 2J55L 2OK4D 3PXSC 2I0RD 2IURD 3PXTC 2MADL 2H47B 3RN0C 2OIZD 2BBKL 2HKRD 4FA9C 1MG2B 2AGYD 2I0TD 3ORVC 2HKMD 1MG3B 3SWSC 4FB1C 4FA5C 2I0SD 3C75L 1MAEL 4O1QC 4FA1C 3SJLC 2Q7QD 3L4OC 4L3GC 2IUPD 3RN1C 2J56L 2GC4B 2AGZD 2J57K 2AGWD 2AGLD 2OK6D 3SVWC 3RLMC 1MDAL 4Y5RC 3SXTC 2IUVD 2AH1D 2IAAB
chains in the Genus database with same CATH superfamily
2H3XB 4FA4C 2AH0D 2HXCD 3SLEC 2GC7B 2AGXD 2HJ4D 3L4MC 4L3HC 3RMZC 4L1QC 2MTAL 4FANC 2HJBD 2IUQD 2OJYD 4K3IC 4FAVC 3PXWC 1MAFL 2J55L 2OK4D 3PXSC 2I0RD 2IURD 3PXTC 2MADL 2H47B 3RN0C 2OIZD 2BBKL 2HKRD 4FA9C 1MG2B 2AGYD 2I0TD 3ORVC 2HKMD 1MG3B 3SWSC 4FB1C 4FA5C 2I0SD 3C75L 1MAEL 4O1QC 4FA1C 3SJLC 2Q7QD 3L4OC 4L3GC 2IUPD 3RN1C 2J56L 2GC4B 2AGZD 2J57K 2AGWD 2AGLD 2OK6D 3SVWC 3RLMC 1MDAL 4Y5RC 3SXTC 2IUVD 2AH1D 2IAAB
chains in the Genus database with same CATH topology
2H3XB 4FA4C 2AH0D 2HXCD 3SLEC 2GC7B 2AGXD 2HJ4D 3L4MC 4L3HC 3RMZC 4L1QC 2MTAL 4FANC 2HJBD 2IUQD 2OJYD 4K3IC 4FAVC 3PXWC 1MAFL 2J55L 2OK4D 3PXSC 2I0RD 2IURD 3PXTC 2MADL 2H47B 3RN0C 2OIZD 2BBKL 2HKRD 4FA9C 1MG2B 2AGYD 2I0TD 3ORVC 2HKMD 1MG3B 3SWSC 4FB1C 4FA5C 2I0SD 3C75L 1MAEL 4O1QC 4FA1C 3SJLC 2Q7QD 3L4OC 4L3GC 2IUPD 3RN1C 2J56L 2GC4B 2AGZD 2J57K 2AGWD 2AGLD 2OK6D 3SVWC 3RLMC 1MDAL 4Y5RC 3SXTC 2IUVD 2AH1D 2IAAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3X B;  4FA4 C;  2AH0 D;  2HXC D;  3SLE C;  2GC7 B;  2AGX D;  2HJ4 D;  3L4M C;  4L3H C;  3RMZ C;  4L1Q C;  2MTA L;  4FAN C;  2HJB D;  2IUQ D;  2OJY D;  4K3I C;  4FAV C;  3PXW C;  1MAF L;  2J55 L;  2OK4 D;  3PXS C;  2I0R D;  2IUR D;  3PXT C;  2MAD L;  2H47 B;  3RN0 C;  2OIZ D;  2BBK L;  2HKR D;  4FA9 C;  1MG2 B;  2AGY D;  2I0T D;  3ORV C;  2HKM D;  1MG3 B;  3SWS C;  4FB1 C;  4FA5 C;  2I0S D;  3C75 L;  1MAE L;  4O1Q C;  4FA1 C;  3SJL C;  2Q7Q D;  3L4O C;  4L3G C;  2IUP D;  3RN1 C;  2J56 L;  2GC4 B;  2AGZ D;  2J57 K;  2AGW D;  2AGL D;  2OK6 D;  3SVW C;  3RLM C;  1MDA L;  4Y5R C;  3SXT C;  2IUV D;  2AH1 D;  2IAA B; 
#chains in the Genus database with same CATH topology
 2H3X B;  4FA4 C;  2AH0 D;  2HXC D;  3SLE C;  2GC7 B;  2AGX D;  2HJ4 D;  3L4M C;  4L3H C;  3RMZ C;  4L1Q C;  2MTA L;  4FAN C;  2HJB D;  2IUQ D;  2OJY D;  4K3I C;  4FAV C;  3PXW C;  1MAF L;  2J55 L;  2OK4 D;  3PXS C;  2I0R D;  2IUR D;  3PXT C;  2MAD L;  2H47 B;  3RN0 C;  2OIZ D;  2BBK L;  2HKR D;  4FA9 C;  1MG2 B;  2AGY D;  2I0T D;  3ORV C;  2HKM D;  1MG3 B;  3SWS C;  4FB1 C;  4FA5 C;  2I0S D;  3C75 L;  1MAE L;  4O1Q C;  4FA1 C;  3SJL C;  2Q7Q D;  3L4O C;  4L3G C;  2IUP D;  3RN1 C;  2J56 L;  2GC4 B;  2AGZ D;  2J57 K;  2AGW D;  2AGL D;  2OK6 D;  3SVW C;  3RLM C;  1MDA L;  4Y5R C;  3SXT C;  2IUV D;  2AH1 D;  2IAA B; 
#chains in the Genus database with same CATH homology
 2H3X B;  4FA4 C;  2AH0 D;  2HXC D;  3SLE C;  2GC7 B;  2AGX D;  2HJ4 D;  3L4M C;  4L3H C;  3RMZ C;  4L1Q C;  2MTA L;  4FAN C;  2HJB D;  2IUQ D;  2OJY D;  4K3I C;  4FAV C;  3PXW C;  1MAF L;  2J55 L;  2OK4 D;  3PXS C;  2I0R D;  2IUR D;  3PXT C;  2MAD L;  2H47 B;  3RN0 C;  2OIZ D;  2BBK L;  2HKR D;  4FA9 C;  1MG2 B;  2AGY D;  2I0T D;  3ORV C;  2HKM D;  1MG3 B;  3SWS C;  4FB1 C;  4FA5 C;  2I0S D;  3C75 L;  1MAE L;  4O1Q C;  4FA1 C;  3SJL C;  2Q7Q D;  3L4O C;  4L3G C;  2IUP D;  3RN1 C;  2J56 L;  2GC4 B;  2AGZ D;  2J57 K;  2AGW D;  2AGL D;  2OK6 D;  3SVW C;  3RLM C;  1MDA L;  4Y5R C;  3SXT C;  2IUV D;  2AH1 D;  2IAA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...