2IUQD

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iuqD00
4K3IC 1MG3B 2AGLD 3C75L 3RLMC 1MAEL 3SXTC 2H47B 2I0RD 2AGWD 2HKMD 3PXWC 3RN1C 3RMZC 3SJLC 3L4OC 2AGZD 2GC4B 2J57K 4Y5RC 2HKRD 4FAVC 2Q7QD 2I0SD 2J55L 3SLEC 4L3HC 4O1QC 3SWSC 2MADL 4FA4C 2AGXD 1MG2B 2OK4D 3L4MC 2H3XB 2HJ4D 4FA5C 2AH0D 2HXCD 4L3GC 3RN0C 1MDAL 4FB1C 4L1QC 3SVWC 2GC7B 2MTAL 2BBKL 2I0TD 2J56L 2AH1D 3PXSC 4FANC 2IUPD 2HJBD 2IURD 2IAAB 2OK6D 2OIZD 2OJYD 4FA1C 4FA9C 3PXTC 2AGYD 2IUQD 2IUVD 1MAFL 3ORVC
chains in the Genus database with same CATH superfamily
4K3IC 1MG3B 2AGLD 3C75L 3RLMC 1MAEL 3SXTC 2H47B 2I0RD 2AGWD 2HKMD 3PXWC 3RN1C 3RMZC 3SJLC 3L4OC 2AGZD 2GC4B 2J57K 4Y5RC 2HKRD 4FAVC 2Q7QD 2I0SD 2J55L 3SLEC 4L3HC 4O1QC 3SWSC 2MADL 4FA4C 2AGXD 1MG2B 2OK4D 3L4MC 2H3XB 2HJ4D 4FA5C 2AH0D 2HXCD 4L3GC 3RN0C 1MDAL 4FB1C 4L1QC 3SVWC 2GC7B 2MTAL 2BBKL 2I0TD 2J56L 2AH1D 3PXSC 4FANC 2IUPD 2HJBD 2IURD 2IAAB 2OK6D 2OIZD 2OJYD 4FA1C 4FA9C 3PXTC 2AGYD 2IUQD 2IUVD 1MAFL 3ORVC
chains in the Genus database with same CATH topology
4K3IC 1MG3B 2AGLD 3C75L 3RLMC 1MAEL 3SXTC 2H47B 2I0RD 2AGWD 2HKMD 3PXWC 3RN1C 3RMZC 3SJLC 3L4OC 2AGZD 2GC4B 2J57K 4Y5RC 2HKRD 4FAVC 2Q7QD 2I0SD 2J55L 3SLEC 4L3HC 4O1QC 3SWSC 2MADL 4FA4C 2AGXD 1MG2B 2OK4D 3L4MC 2H3XB 2HJ4D 4FA5C 2AH0D 2HXCD 4L3GC 3RN0C 1MDAL 4FB1C 4L1QC 3SVWC 2GC7B 2MTAL 2BBKL 2I0TD 2J56L 2AH1D 3PXSC 4FANC 2IUPD 2HJBD 2IURD 2IAAB 2OK6D 2OIZD 2OJYD 4FA1C 4FA9C 3PXTC 2AGYD 2IUQD 2IUVD 1MAFL 3ORVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3I C;  1MG3 B;  2AGL D;  3C75 L;  3RLM C;  1MAE L;  3SXT C;  2H47 B;  2I0R D;  2AGW D;  2HKM D;  3PXW C;  3RN1 C;  3RMZ C;  3SJL C;  3L4O C;  2AGZ D;  2GC4 B;  2J57 K;  4Y5R C;  2HKR D;  4FAV C;  2Q7Q D;  2I0S D;  2J55 L;  3SLE C;  4L3H C;  4O1Q C;  3SWS C;  2MAD L;  4FA4 C;  2AGX D;  1MG2 B;  2OK4 D;  3L4M C;  2H3X B;  2HJ4 D;  4FA5 C;  2AH0 D;  2HXC D;  4L3G C;  3RN0 C;  1MDA L;  4FB1 C;  4L1Q C;  3SVW C;  2GC7 B;  2MTA L;  2BBK L;  2I0T D;  2J56 L;  2AH1 D;  3PXS C;  4FAN C;  2IUP D;  2HJB D;  2IUR D;  2IAA B;  2OK6 D;  2OIZ D;  2OJY D;  4FA1 C;  4FA9 C;  3PXT C;  2AGY D;  2IUQ D;  2IUV D;  1MAF L;  3ORV C; 
#chains in the Genus database with same CATH topology
 4K3I C;  1MG3 B;  2AGL D;  3C75 L;  3RLM C;  1MAE L;  3SXT C;  2H47 B;  2I0R D;  2AGW D;  2HKM D;  3PXW C;  3RN1 C;  3RMZ C;  3SJL C;  3L4O C;  2AGZ D;  2GC4 B;  2J57 K;  4Y5R C;  2HKR D;  4FAV C;  2Q7Q D;  2I0S D;  2J55 L;  3SLE C;  4L3H C;  4O1Q C;  3SWS C;  2MAD L;  4FA4 C;  2AGX D;  1MG2 B;  2OK4 D;  3L4M C;  2H3X B;  2HJ4 D;  4FA5 C;  2AH0 D;  2HXC D;  4L3G C;  3RN0 C;  1MDA L;  4FB1 C;  4L1Q C;  3SVW C;  2GC7 B;  2MTA L;  2BBK L;  2I0T D;  2J56 L;  2AH1 D;  3PXS C;  4FAN C;  2IUP D;  2HJB D;  2IUR D;  2IAA B;  2OK6 D;  2OIZ D;  2OJY D;  4FA1 C;  4FA9 C;  3PXT C;  2AGY D;  2IUQ D;  2IUV D;  1MAF L;  3ORV C; 
#chains in the Genus database with same CATH homology
 4K3I C;  1MG3 B;  2AGL D;  3C75 L;  3RLM C;  1MAE L;  3SXT C;  2H47 B;  2I0R D;  2AGW D;  2HKM D;  3PXW C;  3RN1 C;  3RMZ C;  3SJL C;  3L4O C;  2AGZ D;  2GC4 B;  2J57 K;  4Y5R C;  2HKR D;  4FAV C;  2Q7Q D;  2I0S D;  2J55 L;  3SLE C;  4L3H C;  4O1Q C;  3SWS C;  2MAD L;  4FA4 C;  2AGX D;  1MG2 B;  2OK4 D;  3L4M C;  2H3X B;  2HJ4 D;  4FA5 C;  2AH0 D;  2HXC D;  4L3G C;  3RN0 C;  1MDA L;  4FB1 C;  4L1Q C;  3SVW C;  2GC7 B;  2MTA L;  2BBK L;  2I0T D;  2J56 L;  2AH1 D;  3PXS C;  4FAN C;  2IUP D;  2HJB D;  2IUR D;  2IAA B;  2OK6 D;  2OIZ D;  2OJY D;  4FA1 C;  4FA9 C;  3PXT C;  2AGY D;  2IUQ D;  2IUV D;  1MAF L;  3ORV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...