2IUQD

Crystal structure of dithionite-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iuqD00
1MAEL 2J57K 3PXSC 3RN1C 3RN0C 2BBKL 4FAVC 3SJLC 2J55L 4L3HC 4FA4C 2AH0D 2J56L 2OIZD 3SLEC 2I0RD 4FB1C 1MDAL 4L3GC 2IUPD 3RMZC 3SWSC 2AGWD 2HXCD 2MADL 2OK6D 4Y5RC 2HKRD 2IURD 2IUQD 2I0SD 2AGXD 3PXWC 3RLMC 2HKMD 4FA5C 2HJBD 4FA1C 3ORVC 3SXTC 3SVWC 3L4OC 2GC7B 2HJ4D 1MG2B 2Q7QD 2AGZD 2H3XB 2IAAB 4O1QC 2H47B 2MTAL 2AH1D 2I0TD 2OK4D 3C75L 4FANC 2GC4B 2AGYD 3PXTC 4FA9C 3L4MC 2AGLD 1MAFL 2IUVD 2OJYD 1MG3B 4K3IC 4L1QC
chains in the Genus database with same CATH superfamily
1MAEL 2J57K 3PXSC 3RN1C 3RN0C 2BBKL 4FAVC 3SJLC 2J55L 4L3HC 4FA4C 2AH0D 2J56L 2OIZD 3SLEC 2I0RD 4FB1C 1MDAL 4L3GC 2IUPD 3RMZC 3SWSC 2AGWD 2HXCD 2MADL 2OK6D 4Y5RC 2HKRD 2IURD 2IUQD 2I0SD 2AGXD 3PXWC 3RLMC 2HKMD 4FA5C 2HJBD 4FA1C 3ORVC 3SXTC 3SVWC 3L4OC 2GC7B 2HJ4D 1MG2B 2Q7QD 2AGZD 2H3XB 2IAAB 4O1QC 2H47B 2MTAL 2AH1D 2I0TD 2OK4D 3C75L 4FANC 2GC4B 2AGYD 3PXTC 4FA9C 3L4MC 2AGLD 1MAFL 2IUVD 2OJYD 1MG3B 4K3IC 4L1QC
chains in the Genus database with same CATH topology
1MAEL 2J57K 3PXSC 3RN1C 3RN0C 2BBKL 4FAVC 3SJLC 2J55L 4L3HC 4FA4C 2AH0D 2J56L 2OIZD 3SLEC 2I0RD 4FB1C 1MDAL 4L3GC 2IUPD 3RMZC 3SWSC 2AGWD 2HXCD 2MADL 2OK6D 4Y5RC 2HKRD 2IURD 2IUQD 2I0SD 2AGXD 3PXWC 3RLMC 2HKMD 4FA5C 2HJBD 4FA1C 3ORVC 3SXTC 3SVWC 3L4OC 2GC7B 2HJ4D 1MG2B 2Q7QD 2AGZD 2H3XB 2IAAB 4O1QC 2H47B 2MTAL 2AH1D 2I0TD 2OK4D 3C75L 4FANC 2GC4B 2AGYD 3PXTC 4FA9C 3L4MC 2AGLD 1MAFL 2IUVD 2OJYD 1MG3B 4K3IC 4L1QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAE L;  2J57 K;  3PXS C;  3RN1 C;  3RN0 C;  2BBK L;  4FAV C;  3SJL C;  2J55 L;  4L3H C;  4FA4 C;  2AH0 D;  2J56 L;  2OIZ D;  3SLE C;  2I0R D;  4FB1 C;  1MDA L;  4L3G C;  2IUP D;  3RMZ C;  3SWS C;  2AGW D;  2HXC D;  2MAD L;  2OK6 D;  4Y5R C;  2HKR D;  2IUR D;  2IUQ D;  2I0S D;  2AGX D;  3PXW C;  3RLM C;  2HKM D;  4FA5 C;  2HJB D;  4FA1 C;  3ORV C;  3SXT C;  3SVW C;  3L4O C;  2GC7 B;  2HJ4 D;  1MG2 B;  2Q7Q D;  2AGZ D;  2H3X B;  2IAA B;  4O1Q C;  2H47 B;  2MTA L;  2AH1 D;  2I0T D;  2OK4 D;  3C75 L;  4FAN C;  2GC4 B;  2AGY D;  3PXT C;  4FA9 C;  3L4M C;  2AGL D;  1MAF L;  2IUV D;  2OJY D;  1MG3 B;  4K3I C;  4L1Q C; 
#chains in the Genus database with same CATH topology
 1MAE L;  2J57 K;  3PXS C;  3RN1 C;  3RN0 C;  2BBK L;  4FAV C;  3SJL C;  2J55 L;  4L3H C;  4FA4 C;  2AH0 D;  2J56 L;  2OIZ D;  3SLE C;  2I0R D;  4FB1 C;  1MDA L;  4L3G C;  2IUP D;  3RMZ C;  3SWS C;  2AGW D;  2HXC D;  2MAD L;  2OK6 D;  4Y5R C;  2HKR D;  2IUR D;  2IUQ D;  2I0S D;  2AGX D;  3PXW C;  3RLM C;  2HKM D;  4FA5 C;  2HJB D;  4FA1 C;  3ORV C;  3SXT C;  3SVW C;  3L4O C;  2GC7 B;  2HJ4 D;  1MG2 B;  2Q7Q D;  2AGZ D;  2H3X B;  2IAA B;  4O1Q C;  2H47 B;  2MTA L;  2AH1 D;  2I0T D;  2OK4 D;  3C75 L;  4FAN C;  2GC4 B;  2AGY D;  3PXT C;  4FA9 C;  3L4M C;  2AGL D;  1MAF L;  2IUV D;  2OJY D;  1MG3 B;  4K3I C;  4L1Q C; 
#chains in the Genus database with same CATH homology
 1MAE L;  2J57 K;  3PXS C;  3RN1 C;  3RN0 C;  2BBK L;  4FAV C;  3SJL C;  2J55 L;  4L3H C;  4FA4 C;  2AH0 D;  2J56 L;  2OIZ D;  3SLE C;  2I0R D;  4FB1 C;  1MDA L;  4L3G C;  2IUP D;  3RMZ C;  3SWS C;  2AGW D;  2HXC D;  2MAD L;  2OK6 D;  4Y5R C;  2HKR D;  2IUR D;  2IUQ D;  2I0S D;  2AGX D;  3PXW C;  3RLM C;  2HKM D;  4FA5 C;  2HJB D;  4FA1 C;  3ORV C;  3SXT C;  3SVW C;  3L4O C;  2GC7 B;  2HJ4 D;  1MG2 B;  2Q7Q D;  2AGZ D;  2H3X B;  2IAA B;  4O1Q C;  2H47 B;  2MTA L;  2AH1 D;  2I0T D;  2OK4 D;  3C75 L;  4FAN C;  2GC4 B;  2AGY D;  3PXT C;  4FA9 C;  3L4M C;  2AGL D;  1MAF L;  2IUV D;  2OJY D;  1MG3 B;  4K3I C;  4L1Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...