2HKMD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with phenylethylamine.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
total genus 27
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hkmD00
3ORVC 2MTAL 2OK6D 2J57K 3RN1C 3PXTC 2AGLD 3RN0C 3SWSC 2IUVD 2J56L 3L4MC 4Y5RC 4FA1C 2Q7QD 2GC7B 2OJYD 1MG3B 2AGXD 2IAAB 2OIZD 2AH0D 2J55L 2H3XB 2AGWD 4FA5C 2HKMD 3C75L 3PXWC 3SJLC 2AH1D 2I0RD 2AGYD 3SXTC 1MG2B 4FAVC 2IURD 2HJ4D 4FANC 4O1QC 2HJBD 4FA4C 2I0SD 2OK4D 4L1QC 4L3GC 2H47B 2IUQD 4FA9C 2GC4B 4FB1C 3SVWC 3RLMC 2BBKL 3L4OC 2HXCD 4L3HC 3RMZC 3SLEC 1MAEL 2HKRD 2I0TD 2MADL 1MAFL 4K3IC 3PXSC 2IUPD 2AGZD 1MDAL
chains in the Genus database with same CATH superfamily
3ORVC 2MTAL 2OK6D 2J57K 3RN1C 3PXTC 2AGLD 3RN0C 3SWSC 2IUVD 2J56L 3L4MC 4Y5RC 4FA1C 2Q7QD 2GC7B 2OJYD 1MG3B 2AGXD 2IAAB 2OIZD 2AH0D 2J55L 2H3XB 2AGWD 4FA5C 2HKMD 3C75L 3PXWC 3SJLC 2AH1D 2I0RD 2AGYD 3SXTC 1MG2B 4FAVC 2IURD 2HJ4D 4FANC 4O1QC 2HJBD 4FA4C 2I0SD 2OK4D 4L1QC 4L3GC 2H47B 2IUQD 4FA9C 2GC4B 4FB1C 3SVWC 3RLMC 2BBKL 3L4OC 2HXCD 4L3HC 3RMZC 3SLEC 1MAEL 2HKRD 2I0TD 2MADL 1MAFL 4K3IC 3PXSC 2IUPD 2AGZD 1MDAL
chains in the Genus database with same CATH topology
3ORVC 2MTAL 2OK6D 2J57K 3RN1C 3PXTC 2AGLD 3RN0C 3SWSC 2IUVD 2J56L 3L4MC 4Y5RC 4FA1C 2Q7QD 2GC7B 2OJYD 1MG3B 2AGXD 2IAAB 2OIZD 2AH0D 2J55L 2H3XB 2AGWD 4FA5C 2HKMD 3C75L 3PXWC 3SJLC 2AH1D 2I0RD 2AGYD 3SXTC 1MG2B 4FAVC 2IURD 2HJ4D 4FANC 4O1QC 2HJBD 4FA4C 2I0SD 2OK4D 4L1QC 4L3GC 2H47B 2IUQD 4FA9C 2GC4B 4FB1C 3SVWC 3RLMC 2BBKL 3L4OC 2HXCD 4L3HC 3RMZC 3SLEC 1MAEL 2HKRD 2I0TD 2MADL 1MAFL 4K3IC 3PXSC 2IUPD 2AGZD 1MDAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORV C;  2MTA L;  2OK6 D;  2J57 K;  3RN1 C;  3PXT C;  2AGL D;  3RN0 C;  3SWS C;  2IUV D;  2J56 L;  3L4M C;  4Y5R C;  4FA1 C;  2Q7Q D;  2GC7 B;  2OJY D;  1MG3 B;  2AGX D;  2IAA B;  2OIZ D;  2AH0 D;  2J55 L;  2H3X B;  2AGW D;  4FA5 C;  2HKM D;  3C75 L;  3PXW C;  3SJL C;  2AH1 D;  2I0R D;  2AGY D;  3SXT C;  1MG2 B;  4FAV C;  2IUR D;  2HJ4 D;  4FAN C;  4O1Q C;  2HJB D;  4FA4 C;  2I0S D;  2OK4 D;  4L1Q C;  4L3G C;  2H47 B;  2IUQ D;  4FA9 C;  2GC4 B;  4FB1 C;  3SVW C;  3RLM C;  2BBK L;  3L4O C;  2HXC D;  4L3H C;  3RMZ C;  3SLE C;  1MAE L;  2HKR D;  2I0T D;  2MAD L;  1MAF L;  4K3I C;  3PXS C;  2IUP D;  2AGZ D;  1MDA L; 
#chains in the Genus database with same CATH topology
 3ORV C;  2MTA L;  2OK6 D;  2J57 K;  3RN1 C;  3PXT C;  2AGL D;  3RN0 C;  3SWS C;  2IUV D;  2J56 L;  3L4M C;  4Y5R C;  4FA1 C;  2Q7Q D;  2GC7 B;  2OJY D;  1MG3 B;  2AGX D;  2IAA B;  2OIZ D;  2AH0 D;  2J55 L;  2H3X B;  2AGW D;  4FA5 C;  2HKM D;  3C75 L;  3PXW C;  3SJL C;  2AH1 D;  2I0R D;  2AGY D;  3SXT C;  1MG2 B;  4FAV C;  2IUR D;  2HJ4 D;  4FAN C;  4O1Q C;  2HJB D;  4FA4 C;  2I0S D;  2OK4 D;  4L1Q C;  4L3G C;  2H47 B;  2IUQ D;  4FA9 C;  2GC4 B;  4FB1 C;  3SVW C;  3RLM C;  2BBK L;  3L4O C;  2HXC D;  4L3H C;  3RMZ C;  3SLE C;  1MAE L;  2HKR D;  2I0T D;  2MAD L;  1MAF L;  4K3I C;  3PXS C;  2IUP D;  2AGZ D;  1MDA L; 
#chains in the Genus database with same CATH homology
 3ORV C;  2MTA L;  2OK6 D;  2J57 K;  3RN1 C;  3PXT C;  2AGL D;  3RN0 C;  3SWS C;  2IUV D;  2J56 L;  3L4M C;  4Y5R C;  4FA1 C;  2Q7Q D;  2GC7 B;  2OJY D;  1MG3 B;  2AGX D;  2IAA B;  2OIZ D;  2AH0 D;  2J55 L;  2H3X B;  2AGW D;  4FA5 C;  2HKM D;  3C75 L;  3PXW C;  3SJL C;  2AH1 D;  2I0R D;  2AGY D;  3SXT C;  1MG2 B;  4FAV C;  2IUR D;  2HJ4 D;  4FAN C;  4O1Q C;  2HJB D;  4FA4 C;  2I0S D;  2OK4 D;  4L1Q C;  4L3G C;  2H47 B;  2IUQ D;  4FA9 C;  2GC4 B;  4FB1 C;  3SVW C;  3RLM C;  2BBK L;  3L4O C;  2HXC D;  4L3H C;  3RMZ C;  3SLE C;  1MAE L;  2HKR D;  2I0T D;  2MAD L;  1MAF L;  4K3I C;  3PXS C;  2IUP D;  2AGZ D;  1MDA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...