2HKMD

Crystal structure of the schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with phenylethylamine.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
molecule tags Oxidoreductase
total genus 27
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hkmD00
2HXCD 2IUVD 2OK4D 3PXWC 3RLMC 2J57K 3C75L 4FANC 2AGZD 3PXTC 3RN0C 3PXSC 2AGXD 2IAAB 4FB1C 2IURD 2AGLD 4L1QC 2OJYD 4L3GC 3SJLC 4FAVC 3SLEC 2GC7B 2HJBD 2J55L 3ORVC 1MG2B 2AGWD 4FA9C 2H3XB 2OK6D 1MG3B 2GC4B 2I0RD 4L3HC 3RN1C 4FA1C 1MDAL 2Q7QD 2AH1D 2IUPD 1MAEL 2J56L 2HKMD 4FA4C 2AH0D 3L4OC 4K3IC 4Y5RC 2HKRD 4FA5C 3RMZC 2I0SD 4O1QC 2BBKL 2AGYD 2HJ4D 2IUQD 3SWSC 2MTAL 2OIZD 3SXTC 2I0TD 1MAFL 3L4MC 2H47B 3SVWC 2MADL
chains in the Genus database with same CATH superfamily
2HXCD 2IUVD 2OK4D 3PXWC 3RLMC 2J57K 3C75L 4FANC 2AGZD 3PXTC 3RN0C 3PXSC 2AGXD 2IAAB 4FB1C 2IURD 2AGLD 4L1QC 2OJYD 4L3GC 3SJLC 4FAVC 3SLEC 2GC7B 2HJBD 2J55L 3ORVC 1MG2B 2AGWD 4FA9C 2H3XB 2OK6D 1MG3B 2GC4B 2I0RD 4L3HC 3RN1C 4FA1C 1MDAL 2Q7QD 2AH1D 2IUPD 1MAEL 2J56L 2HKMD 4FA4C 2AH0D 3L4OC 4K3IC 4Y5RC 2HKRD 4FA5C 3RMZC 2I0SD 4O1QC 2BBKL 2AGYD 2HJ4D 2IUQD 3SWSC 2MTAL 2OIZD 3SXTC 2I0TD 1MAFL 3L4MC 2H47B 3SVWC 2MADL
chains in the Genus database with same CATH topology
2HXCD 2IUVD 2OK4D 3PXWC 3RLMC 2J57K 3C75L 4FANC 2AGZD 3PXTC 3RN0C 3PXSC 2AGXD 2IAAB 4FB1C 2IURD 2AGLD 4L1QC 2OJYD 4L3GC 3SJLC 4FAVC 3SLEC 2GC7B 2HJBD 2J55L 3ORVC 1MG2B 2AGWD 4FA9C 2H3XB 2OK6D 1MG3B 2GC4B 2I0RD 4L3HC 3RN1C 4FA1C 1MDAL 2Q7QD 2AH1D 2IUPD 1MAEL 2J56L 2HKMD 4FA4C 2AH0D 3L4OC 4K3IC 4Y5RC 2HKRD 4FA5C 3RMZC 2I0SD 4O1QC 2BBKL 2AGYD 2HJ4D 2IUQD 3SWSC 2MTAL 2OIZD 3SXTC 2I0TD 1MAFL 3L4MC 2H47B 3SVWC 2MADL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXC D;  2IUV D;  2OK4 D;  3PXW C;  3RLM C;  2J57 K;  3C75 L;  4FAN C;  2AGZ D;  3PXT C;  3RN0 C;  3PXS C;  2AGX D;  2IAA B;  4FB1 C;  2IUR D;  2AGL D;  4L1Q C;  2OJY D;  4L3G C;  3SJL C;  4FAV C;  3SLE C;  2GC7 B;  2HJB D;  2J55 L;  3ORV C;  1MG2 B;  2AGW D;  4FA9 C;  2H3X B;  2OK6 D;  1MG3 B;  2GC4 B;  2I0R D;  4L3H C;  3RN1 C;  4FA1 C;  1MDA L;  2Q7Q D;  2AH1 D;  2IUP D;  1MAE L;  2J56 L;  2HKM D;  4FA4 C;  2AH0 D;  3L4O C;  4K3I C;  4Y5R C;  2HKR D;  4FA5 C;  3RMZ C;  2I0S D;  4O1Q C;  2BBK L;  2AGY D;  2HJ4 D;  2IUQ D;  3SWS C;  2MTA L;  2OIZ D;  3SXT C;  2I0T D;  1MAF L;  3L4M C;  2H47 B;  3SVW C;  2MAD L; 
#chains in the Genus database with same CATH topology
 2HXC D;  2IUV D;  2OK4 D;  3PXW C;  3RLM C;  2J57 K;  3C75 L;  4FAN C;  2AGZ D;  3PXT C;  3RN0 C;  3PXS C;  2AGX D;  2IAA B;  4FB1 C;  2IUR D;  2AGL D;  4L1Q C;  2OJY D;  4L3G C;  3SJL C;  4FAV C;  3SLE C;  2GC7 B;  2HJB D;  2J55 L;  3ORV C;  1MG2 B;  2AGW D;  4FA9 C;  2H3X B;  2OK6 D;  1MG3 B;  2GC4 B;  2I0R D;  4L3H C;  3RN1 C;  4FA1 C;  1MDA L;  2Q7Q D;  2AH1 D;  2IUP D;  1MAE L;  2J56 L;  2HKM D;  4FA4 C;  2AH0 D;  3L4O C;  4K3I C;  4Y5R C;  2HKR D;  4FA5 C;  3RMZ C;  2I0S D;  4O1Q C;  2BBK L;  2AGY D;  2HJ4 D;  2IUQ D;  3SWS C;  2MTA L;  2OIZ D;  3SXT C;  2I0T D;  1MAF L;  3L4M C;  2H47 B;  3SVW C;  2MAD L; 
#chains in the Genus database with same CATH homology
 2HXC D;  2IUV D;  2OK4 D;  3PXW C;  3RLM C;  2J57 K;  3C75 L;  4FAN C;  2AGZ D;  3PXT C;  3RN0 C;  3PXS C;  2AGX D;  2IAA B;  4FB1 C;  2IUR D;  2AGL D;  4L1Q C;  2OJY D;  4L3G C;  3SJL C;  4FAV C;  3SLE C;  2GC7 B;  2HJB D;  2J55 L;  3ORV C;  1MG2 B;  2AGW D;  4FA9 C;  2H3X B;  2OK6 D;  1MG3 B;  2GC4 B;  2I0R D;  4L3H C;  3RN1 C;  4FA1 C;  1MDA L;  2Q7Q D;  2AH1 D;  2IUP D;  1MAE L;  2J56 L;  2HKM D;  4FA4 C;  2AH0 D;  3L4O C;  4K3I C;  4Y5R C;  2HKR D;  4FA5 C;  3RMZ C;  2I0S D;  4O1Q C;  2BBK L;  2AGY D;  2HJ4 D;  2IUQ D;  3SWS C;  2MTA L;  2OIZ D;  3SXT C;  2I0T D;  1MAF L;  3L4M C;  2H47 B;  3SVW C;  2MAD L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...