2HJ4D

Crystal structure of alcaligenes faecalis aadh complex with p-nitrobenzylamine
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase; chain D, H
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2hj4D00
2I0RD 2IAAB 3PXSC 3RN1C 3RN0C 3L4OC 4FAVC 2HXCD 3ORVC 2AGXD 2J55L 4O1QC 2I0SD 2BBKL 2Q7QD 4Y5RC 3SLEC 4FANC 2J56L 4FA5C 2IUQD 4FA4C 2HJBD 3SWSC 2HJ4D 2AGZD 2AGWD 2MADL 3PXWC 3SVWC 4L1QC 2I0TD 1MAFL 4L3GC 2H47B 2HKRD 2AGYD 2GC4B 3RMZC 4FA1C 3L4MC 4FB1C 2AH1D 2IUVD 2HKMD 2OK6D 4FA9C 1MDAL 3PXTC 2MTAL 1MG3B 2AH0D 3RLMC 1MG2B 4K3IC 2OJYD 1MAEL 3SXTC 2IUPD 4L3HC 2IURD 2AGLD 2GC7B 2J57K 3C75L 2H3XB 2OIZD 2OK4D 3SJLC
chains in the Genus database with same CATH superfamily
2I0RD 2IAAB 3PXSC 3RN1C 3RN0C 3L4OC 4FAVC 2HXCD 3ORVC 2AGXD 2J55L 4O1QC 2I0SD 2BBKL 2Q7QD 4Y5RC 3SLEC 4FANC 2J56L 4FA5C 2IUQD 4FA4C 2HJBD 3SWSC 2HJ4D 2AGZD 2AGWD 2MADL 3PXWC 3SVWC 4L1QC 2I0TD 1MAFL 4L3GC 2H47B 2HKRD 2AGYD 2GC4B 3RMZC 4FA1C 3L4MC 4FB1C 2AH1D 2IUVD 2HKMD 2OK6D 4FA9C 1MDAL 3PXTC 2MTAL 1MG3B 2AH0D 3RLMC 1MG2B 4K3IC 2OJYD 1MAEL 3SXTC 2IUPD 4L3HC 2IURD 2AGLD 2GC7B 2J57K 3C75L 2H3XB 2OIZD 2OK4D 3SJLC
chains in the Genus database with same CATH topology
2I0RD 2IAAB 3PXSC 3RN1C 3RN0C 3L4OC 4FAVC 2HXCD 3ORVC 2AGXD 2J55L 4O1QC 2I0SD 2BBKL 2Q7QD 4Y5RC 3SLEC 4FANC 2J56L 4FA5C 2IUQD 4FA4C 2HJBD 3SWSC 2HJ4D 2AGZD 2AGWD 2MADL 3PXWC 3SVWC 4L1QC 2I0TD 1MAFL 4L3GC 2H47B 2HKRD 2AGYD 2GC4B 3RMZC 4FA1C 3L4MC 4FB1C 2AH1D 2IUVD 2HKMD 2OK6D 4FA9C 1MDAL 3PXTC 2MTAL 1MG3B 2AH0D 3RLMC 1MG2B 4K3IC 2OJYD 1MAEL 3SXTC 2IUPD 4L3HC 2IURD 2AGLD 2GC7B 2J57K 3C75L 2H3XB 2OIZD 2OK4D 3SJLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0R D;  2IAA B;  3PXS C;  3RN1 C;  3RN0 C;  3L4O C;  4FAV C;  2HXC D;  3ORV C;  2AGX D;  2J55 L;  4O1Q C;  2I0S D;  2BBK L;  2Q7Q D;  4Y5R C;  3SLE C;  4FAN C;  2J56 L;  4FA5 C;  2IUQ D;  4FA4 C;  2HJB D;  3SWS C;  2HJ4 D;  2AGZ D;  2AGW D;  2MAD L;  3PXW C;  3SVW C;  4L1Q C;  2I0T D;  1MAF L;  4L3G C;  2H47 B;  2HKR D;  2AGY D;  2GC4 B;  3RMZ C;  4FA1 C;  3L4M C;  4FB1 C;  2AH1 D;  2IUV D;  2HKM D;  2OK6 D;  4FA9 C;  1MDA L;  3PXT C;  2MTA L;  1MG3 B;  2AH0 D;  3RLM C;  1MG2 B;  4K3I C;  2OJY D;  1MAE L;  3SXT C;  2IUP D;  4L3H C;  2IUR D;  2AGL D;  2GC7 B;  2J57 K;  3C75 L;  2H3X B;  2OIZ D;  2OK4 D;  3SJL C; 
#chains in the Genus database with same CATH topology
 2I0R D;  2IAA B;  3PXS C;  3RN1 C;  3RN0 C;  3L4O C;  4FAV C;  2HXC D;  3ORV C;  2AGX D;  2J55 L;  4O1Q C;  2I0S D;  2BBK L;  2Q7Q D;  4Y5R C;  3SLE C;  4FAN C;  2J56 L;  4FA5 C;  2IUQ D;  4FA4 C;  2HJB D;  3SWS C;  2HJ4 D;  2AGZ D;  2AGW D;  2MAD L;  3PXW C;  3SVW C;  4L1Q C;  2I0T D;  1MAF L;  4L3G C;  2H47 B;  2HKR D;  2AGY D;  2GC4 B;  3RMZ C;  4FA1 C;  3L4M C;  4FB1 C;  2AH1 D;  2IUV D;  2HKM D;  2OK6 D;  4FA9 C;  1MDA L;  3PXT C;  2MTA L;  1MG3 B;  2AH0 D;  3RLM C;  1MG2 B;  4K3I C;  2OJY D;  1MAE L;  3SXT C;  2IUP D;  4L3H C;  2IUR D;  2AGL D;  2GC7 B;  2J57 K;  3C75 L;  2H3X B;  2OIZ D;  2OK4 D;  3SJL C; 
#chains in the Genus database with same CATH homology
 2I0R D;  2IAA B;  3PXS C;  3RN1 C;  3RN0 C;  3L4O C;  4FAV C;  2HXC D;  3ORV C;  2AGX D;  2J55 L;  4O1Q C;  2I0S D;  2BBK L;  2Q7Q D;  4Y5R C;  3SLE C;  4FAN C;  2J56 L;  4FA5 C;  2IUQ D;  4FA4 C;  2HJB D;  3SWS C;  2HJ4 D;  2AGZ D;  2AGW D;  2MAD L;  3PXW C;  3SVW C;  4L1Q C;  2I0T D;  1MAF L;  4L3G C;  2H47 B;  2HKR D;  2AGY D;  2GC4 B;  3RMZ C;  4FA1 C;  3L4M C;  4FB1 C;  2AH1 D;  2IUV D;  2HKM D;  2OK6 D;  4FA9 C;  1MDA L;  3PXT C;  2MTA L;  1MG3 B;  2AH0 D;  3RLM C;  1MG2 B;  4K3I C;  2OJY D;  1MAE L;  3SXT C;  2IUP D;  4L3H C;  2IUR D;  2AGL D;  2GC7 B;  2J57 K;  3C75 L;  2H3X B;  2OIZ D;  2OK4 D;  3SJL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...