4L1QC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 32
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l1qC00
3PXWC 2AGZD 4K3IC 2IAAB 3SXTC 2I0RD 4FA4C 2HKMD 3SVWC 4FA9C 4FANC 3C75L 1MG3B 2OJYD 2HJ4D 4FA5C 3RMZC 4L1QC 2AGWD 2GC7B 4O1QC 3RN0C 3PXTC 3SWSC 2Q7QD 4FA1C 2I0TD 2HJBD 1MG2B 2H3XB 3RLMC 2H47B 2MTAL 3RN1C 3L4MC 4L3HC 2AGYD 2OK6D 2AGXD 2I0SD 2OK4D 3ORVC 4Y5RC 3SLEC 2MADL 2J57K 2HXCD 2AH0D 2HKRD 4L3GC 2IUQD 2BBKL 2IUPD 2IURD 1MAFL 3SJLC 1MDAL 2IUVD 2AGLD 2OIZD 2GC4B 2J56L 2J55L 3PXSC 1MAEL 3L4OC 4FAVC 4FB1C 2AH1D
chains in the Genus database with same CATH superfamily
3PXWC 2AGZD 4K3IC 2IAAB 3SXTC 2I0RD 4FA4C 2HKMD 3SVWC 4FA9C 4FANC 3C75L 1MG3B 2OJYD 2HJ4D 4FA5C 3RMZC 4L1QC 2AGWD 2GC7B 4O1QC 3RN0C 3PXTC 3SWSC 2Q7QD 4FA1C 2I0TD 2HJBD 1MG2B 2H3XB 3RLMC 2H47B 2MTAL 3RN1C 3L4MC 4L3HC 2AGYD 2OK6D 2AGXD 2I0SD 2OK4D 3ORVC 4Y5RC 3SLEC 2MADL 2J57K 2HXCD 2AH0D 2HKRD 4L3GC 2IUQD 2BBKL 2IUPD 2IURD 1MAFL 3SJLC 1MDAL 2IUVD 2AGLD 2OIZD 2GC4B 2J56L 2J55L 3PXSC 1MAEL 3L4OC 4FAVC 4FB1C 2AH1D
chains in the Genus database with same CATH topology
3PXWC 2AGZD 4K3IC 2IAAB 3SXTC 2I0RD 4FA4C 2HKMD 3SVWC 4FA9C 4FANC 3C75L 1MG3B 2OJYD 2HJ4D 4FA5C 3RMZC 4L1QC 2AGWD 2GC7B 4O1QC 3RN0C 3PXTC 3SWSC 2Q7QD 4FA1C 2I0TD 2HJBD 1MG2B 2H3XB 3RLMC 2H47B 2MTAL 3RN1C 3L4MC 4L3HC 2AGYD 2OK6D 2AGXD 2I0SD 2OK4D 3ORVC 4Y5RC 3SLEC 2MADL 2J57K 2HXCD 2AH0D 2HKRD 4L3GC 2IUQD 2BBKL 2IUPD 2IURD 1MAFL 3SJLC 1MDAL 2IUVD 2AGLD 2OIZD 2GC4B 2J56L 2J55L 3PXSC 1MAEL 3L4OC 4FAVC 4FB1C 2AH1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXW C;  2AGZ D;  4K3I C;  2IAA B;  3SXT C;  2I0R D;  4FA4 C;  2HKM D;  3SVW C;  4FA9 C;  4FAN C;  3C75 L;  1MG3 B;  2OJY D;  2HJ4 D;  4FA5 C;  3RMZ C;  4L1Q C;  2AGW D;  2GC7 B;  4O1Q C;  3RN0 C;  3PXT C;  3SWS C;  2Q7Q D;  4FA1 C;  2I0T D;  2HJB D;  1MG2 B;  2H3X B;  3RLM C;  2H47 B;  2MTA L;  3RN1 C;  3L4M C;  4L3H C;  2AGY D;  2OK6 D;  2AGX D;  2I0S D;  2OK4 D;  3ORV C;  4Y5R C;  3SLE C;  2MAD L;  2J57 K;  2HXC D;  2AH0 D;  2HKR D;  4L3G C;  2IUQ D;  2BBK L;  2IUP D;  2IUR D;  1MAF L;  3SJL C;  1MDA L;  2IUV D;  2AGL D;  2OIZ D;  2GC4 B;  2J56 L;  2J55 L;  3PXS C;  1MAE L;  3L4O C;  4FAV C;  4FB1 C;  2AH1 D; 
#chains in the Genus database with same CATH topology
 3PXW C;  2AGZ D;  4K3I C;  2IAA B;  3SXT C;  2I0R D;  4FA4 C;  2HKM D;  3SVW C;  4FA9 C;  4FAN C;  3C75 L;  1MG3 B;  2OJY D;  2HJ4 D;  4FA5 C;  3RMZ C;  4L1Q C;  2AGW D;  2GC7 B;  4O1Q C;  3RN0 C;  3PXT C;  3SWS C;  2Q7Q D;  4FA1 C;  2I0T D;  2HJB D;  1MG2 B;  2H3X B;  3RLM C;  2H47 B;  2MTA L;  3RN1 C;  3L4M C;  4L3H C;  2AGY D;  2OK6 D;  2AGX D;  2I0S D;  2OK4 D;  3ORV C;  4Y5R C;  3SLE C;  2MAD L;  2J57 K;  2HXC D;  2AH0 D;  2HKR D;  4L3G C;  2IUQ D;  2BBK L;  2IUP D;  2IUR D;  1MAF L;  3SJL C;  1MDA L;  2IUV D;  2AGL D;  2OIZ D;  2GC4 B;  2J56 L;  2J55 L;  3PXS C;  1MAE L;  3L4O C;  4FAV C;  4FB1 C;  2AH1 D; 
#chains in the Genus database with same CATH homology
 3PXW C;  2AGZ D;  4K3I C;  2IAA B;  3SXT C;  2I0R D;  4FA4 C;  2HKM D;  3SVW C;  4FA9 C;  4FAN C;  3C75 L;  1MG3 B;  2OJY D;  2HJ4 D;  4FA5 C;  3RMZ C;  4L1Q C;  2AGW D;  2GC7 B;  4O1Q C;  3RN0 C;  3PXT C;  3SWS C;  2Q7Q D;  4FA1 C;  2I0T D;  2HJB D;  1MG2 B;  2H3X B;  3RLM C;  2H47 B;  2MTA L;  3RN1 C;  3L4M C;  4L3H C;  2AGY D;  2OK6 D;  2AGX D;  2I0S D;  2OK4 D;  3ORV C;  4Y5R C;  3SLE C;  2MAD L;  2J57 K;  2HXC D;  2AH0 D;  2HKR D;  4L3G C;  2IUQ D;  2BBK L;  2IUP D;  2IUR D;  1MAF L;  3SJL C;  1MDA L;  2IUV D;  2AGL D;  2OIZ D;  2GC4 B;  2J56 L;  2J55 L;  3PXS C;  1MAE L;  3L4O C;  4FAV C;  4FB1 C;  2AH1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...