4L1QC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 32
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l1qC00
3PXSC 2I0RD 2HXCD 2IUQD 3PXTC 2IURD 4FA5C 2BBKL 2IUPD 2AGXD 2HJBD 2I0SD 2AH1D 2AGYD 3L4MC 3C75L 2OJYD 3RMZC 4K3IC 4FANC 3L4OC 4FAVC 1MAFL 4FA4C 4O1QC 2H47B 2J56L 2J57K 2Q7QD 2OK4D 1MDAL 4Y5RC 2IUVD 2OIZD 3RN0C 3RN1C 2I0TD 2H3XB 4FB1C 3SVWC 1MAEL 2MADL 3RLMC 1MG3B 3SWSC 2OK6D 2HJ4D 3SXTC 4L1QC 4FA1C 2MTAL 2AGZD 2GC7B 3SLEC 2IAAB 2AH0D 3SJLC 2AGLD 2HKMD 3ORVC 3PXWC 2HKRD 2AGWD 4FA9C 2J55L 1MG2B 2GC4B 4L3GC 4L3HC
chains in the Genus database with same CATH superfamily
3PXSC 2I0RD 2HXCD 2IUQD 3PXTC 2IURD 4FA5C 2BBKL 2IUPD 2AGXD 2HJBD 2I0SD 2AH1D 2AGYD 3L4MC 3C75L 2OJYD 3RMZC 4K3IC 4FANC 3L4OC 4FAVC 1MAFL 4FA4C 4O1QC 2H47B 2J56L 2J57K 2Q7QD 2OK4D 1MDAL 4Y5RC 2IUVD 2OIZD 3RN0C 3RN1C 2I0TD 2H3XB 4FB1C 3SVWC 1MAEL 2MADL 3RLMC 1MG3B 3SWSC 2OK6D 2HJ4D 3SXTC 4L1QC 4FA1C 2MTAL 2AGZD 2GC7B 3SLEC 2IAAB 2AH0D 3SJLC 2AGLD 2HKMD 3ORVC 3PXWC 2HKRD 2AGWD 4FA9C 2J55L 1MG2B 2GC4B 4L3GC 4L3HC
chains in the Genus database with same CATH topology
3PXSC 2I0RD 2HXCD 2IUQD 3PXTC 2IURD 4FA5C 2BBKL 2IUPD 2AGXD 2HJBD 2I0SD 2AH1D 2AGYD 3L4MC 3C75L 2OJYD 3RMZC 4K3IC 4FANC 3L4OC 4FAVC 1MAFL 4FA4C 4O1QC 2H47B 2J56L 2J57K 2Q7QD 2OK4D 1MDAL 4Y5RC 2IUVD 2OIZD 3RN0C 3RN1C 2I0TD 2H3XB 4FB1C 3SVWC 1MAEL 2MADL 3RLMC 1MG3B 3SWSC 2OK6D 2HJ4D 3SXTC 4L1QC 4FA1C 2MTAL 2AGZD 2GC7B 3SLEC 2IAAB 2AH0D 3SJLC 2AGLD 2HKMD 3ORVC 3PXWC 2HKRD 2AGWD 4FA9C 2J55L 1MG2B 2GC4B 4L3GC 4L3HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXS C;  2I0R D;  2HXC D;  2IUQ D;  3PXT C;  2IUR D;  4FA5 C;  2BBK L;  2IUP D;  2AGX D;  2HJB D;  2I0S D;  2AH1 D;  2AGY D;  3L4M C;  3C75 L;  2OJY D;  3RMZ C;  4K3I C;  4FAN C;  3L4O C;  4FAV C;  1MAF L;  4FA4 C;  4O1Q C;  2H47 B;  2J56 L;  2J57 K;  2Q7Q D;  2OK4 D;  1MDA L;  4Y5R C;  2IUV D;  2OIZ D;  3RN0 C;  3RN1 C;  2I0T D;  2H3X B;  4FB1 C;  3SVW C;  1MAE L;  2MAD L;  3RLM C;  1MG3 B;  3SWS C;  2OK6 D;  2HJ4 D;  3SXT C;  4L1Q C;  4FA1 C;  2MTA L;  2AGZ D;  2GC7 B;  3SLE C;  2IAA B;  2AH0 D;  3SJL C;  2AGL D;  2HKM D;  3ORV C;  3PXW C;  2HKR D;  2AGW D;  4FA9 C;  2J55 L;  1MG2 B;  2GC4 B;  4L3G C;  4L3H C; 
#chains in the Genus database with same CATH topology
 3PXS C;  2I0R D;  2HXC D;  2IUQ D;  3PXT C;  2IUR D;  4FA5 C;  2BBK L;  2IUP D;  2AGX D;  2HJB D;  2I0S D;  2AH1 D;  2AGY D;  3L4M C;  3C75 L;  2OJY D;  3RMZ C;  4K3I C;  4FAN C;  3L4O C;  4FAV C;  1MAF L;  4FA4 C;  4O1Q C;  2H47 B;  2J56 L;  2J57 K;  2Q7Q D;  2OK4 D;  1MDA L;  4Y5R C;  2IUV D;  2OIZ D;  3RN0 C;  3RN1 C;  2I0T D;  2H3X B;  4FB1 C;  3SVW C;  1MAE L;  2MAD L;  3RLM C;  1MG3 B;  3SWS C;  2OK6 D;  2HJ4 D;  3SXT C;  4L1Q C;  4FA1 C;  2MTA L;  2AGZ D;  2GC7 B;  3SLE C;  2IAA B;  2AH0 D;  3SJL C;  2AGL D;  2HKM D;  3ORV C;  3PXW C;  2HKR D;  2AGW D;  4FA9 C;  2J55 L;  1MG2 B;  2GC4 B;  4L3G C;  4L3H C; 
#chains in the Genus database with same CATH homology
 3PXS C;  2I0R D;  2HXC D;  2IUQ D;  3PXT C;  2IUR D;  4FA5 C;  2BBK L;  2IUP D;  2AGX D;  2HJB D;  2I0S D;  2AH1 D;  2AGY D;  3L4M C;  3C75 L;  2OJY D;  3RMZ C;  4K3I C;  4FAN C;  3L4O C;  4FAV C;  1MAF L;  4FA4 C;  4O1Q C;  2H47 B;  2J56 L;  2J57 K;  2Q7Q D;  2OK4 D;  1MDA L;  4Y5R C;  2IUV D;  2OIZ D;  3RN0 C;  3RN1 C;  2I0T D;  2H3X B;  4FB1 C;  3SVW C;  1MAE L;  2MAD L;  3RLM C;  1MG3 B;  3SWS C;  2OK6 D;  2HJ4 D;  3SXT C;  4L1Q C;  4FA1 C;  2MTA L;  2AGZ D;  2GC7 B;  3SLE C;  2IAA B;  2AH0 D;  3SJL C;  2AGL D;  2HKM D;  3ORV C;  3PXW C;  2HKR D;  2AGW D;  4FA9 C;  2J55 L;  1MG2 B;  2GC4 B;  4L3G C;  4L3H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...