4L1QC

Crystal structure of the e113q-maug/pre-methylamine dehydrogenase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
130
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Carboxyl Group of Glu113 Is Required for Stabilization of the Diferrous and Bis-Fe(IV) States of MauG.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 32
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.99.3: Transferred entry: 1.4.9.1.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4l1qC00
2OK4D 2IURD 2HJ4D 3RN0C 3RN1C 2GC4B 4FA1C 4FA5C 3RMZC 1MG2B 3PXTC 2IUQD 2HXCD 2IUPD 2BBKL 2AGZD 2AH0D 4Y5RC 2GC7B 2I0RD 2I0TD 2AH1D 2IAAB 2MADL 2I0SD 3SVWC 2AGYD 4L1QC 4FA9C 3L4OC 3SWSC 1MDAL 3RLMC 1MG3B 3SJLC 2J55L 3PXSC 2OK6D 4O1QC 4FB1C 4K3IC 4L3HC 3SLEC 2OIZD 1MAEL 4FANC 3PXWC 2HKRD 4FA4C 4FAVC 1MAFL 3SXTC 2J56L 2Q7QD 3ORVC 4L3GC 2AGXD 2HJBD 2OJYD 3L4MC 2HKMD 2J57K 2IUVD 2MTAL 2AGWD 2H47B 2AGLD 3C75L 2H3XB
chains in the Genus database with same CATH superfamily
2OK4D 2IURD 2HJ4D 3RN0C 3RN1C 2GC4B 4FA1C 4FA5C 3RMZC 1MG2B 3PXTC 2IUQD 2HXCD 2IUPD 2BBKL 2AGZD 2AH0D 4Y5RC 2GC7B 2I0RD 2I0TD 2AH1D 2IAAB 2MADL 2I0SD 3SVWC 2AGYD 4L1QC 4FA9C 3L4OC 3SWSC 1MDAL 3RLMC 1MG3B 3SJLC 2J55L 3PXSC 2OK6D 4O1QC 4FB1C 4K3IC 4L3HC 3SLEC 2OIZD 1MAEL 4FANC 3PXWC 2HKRD 4FA4C 4FAVC 1MAFL 3SXTC 2J56L 2Q7QD 3ORVC 4L3GC 2AGXD 2HJBD 2OJYD 3L4MC 2HKMD 2J57K 2IUVD 2MTAL 2AGWD 2H47B 2AGLD 3C75L 2H3XB
chains in the Genus database with same CATH topology
2OK4D 2IURD 2HJ4D 3RN0C 3RN1C 2GC4B 4FA1C 4FA5C 3RMZC 1MG2B 3PXTC 2IUQD 2HXCD 2IUPD 2BBKL 2AGZD 2AH0D 4Y5RC 2GC7B 2I0RD 2I0TD 2AH1D 2IAAB 2MADL 2I0SD 3SVWC 2AGYD 4L1QC 4FA9C 3L4OC 3SWSC 1MDAL 3RLMC 1MG3B 3SJLC 2J55L 3PXSC 2OK6D 4O1QC 4FB1C 4K3IC 4L3HC 3SLEC 2OIZD 1MAEL 4FANC 3PXWC 2HKRD 4FA4C 4FAVC 1MAFL 3SXTC 2J56L 2Q7QD 3ORVC 4L3GC 2AGXD 2HJBD 2OJYD 3L4MC 2HKMD 2J57K 2IUVD 2MTAL 2AGWD 2H47B 2AGLD 3C75L 2H3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK4 D;  2IUR D;  2HJ4 D;  3RN0 C;  3RN1 C;  2GC4 B;  4FA1 C;  4FA5 C;  3RMZ C;  1MG2 B;  3PXT C;  2IUQ D;  2HXC D;  2IUP D;  2BBK L;  2AGZ D;  2AH0 D;  4Y5R C;  2GC7 B;  2I0R D;  2I0T D;  2AH1 D;  2IAA B;  2MAD L;  2I0S D;  3SVW C;  2AGY D;  4L1Q C;  4FA9 C;  3L4O C;  3SWS C;  1MDA L;  3RLM C;  1MG3 B;  3SJL C;  2J55 L;  3PXS C;  2OK6 D;  4O1Q C;  4FB1 C;  4K3I C;  4L3H C;  3SLE C;  2OIZ D;  1MAE L;  4FAN C;  3PXW C;  2HKR D;  4FA4 C;  4FAV C;  1MAF L;  3SXT C;  2J56 L;  2Q7Q D;  3ORV C;  4L3G C;  2AGX D;  2HJB D;  2OJY D;  3L4M C;  2HKM D;  2J57 K;  2IUV D;  2MTA L;  2AGW D;  2H47 B;  2AGL D;  3C75 L;  2H3X B; 
#chains in the Genus database with same CATH topology
 2OK4 D;  2IUR D;  2HJ4 D;  3RN0 C;  3RN1 C;  2GC4 B;  4FA1 C;  4FA5 C;  3RMZ C;  1MG2 B;  3PXT C;  2IUQ D;  2HXC D;  2IUP D;  2BBK L;  2AGZ D;  2AH0 D;  4Y5R C;  2GC7 B;  2I0R D;  2I0T D;  2AH1 D;  2IAA B;  2MAD L;  2I0S D;  3SVW C;  2AGY D;  4L1Q C;  4FA9 C;  3L4O C;  3SWS C;  1MDA L;  3RLM C;  1MG3 B;  3SJL C;  2J55 L;  3PXS C;  2OK6 D;  4O1Q C;  4FB1 C;  4K3I C;  4L3H C;  3SLE C;  2OIZ D;  1MAE L;  4FAN C;  3PXW C;  2HKR D;  4FA4 C;  4FAV C;  1MAF L;  3SXT C;  2J56 L;  2Q7Q D;  3ORV C;  4L3G C;  2AGX D;  2HJB D;  2OJY D;  3L4M C;  2HKM D;  2J57 K;  2IUV D;  2MTA L;  2AGW D;  2H47 B;  2AGL D;  3C75 L;  2H3X B; 
#chains in the Genus database with same CATH homology
 2OK4 D;  2IUR D;  2HJ4 D;  3RN0 C;  3RN1 C;  2GC4 B;  4FA1 C;  4FA5 C;  3RMZ C;  1MG2 B;  3PXT C;  2IUQ D;  2HXC D;  2IUP D;  2BBK L;  2AGZ D;  2AH0 D;  4Y5R C;  2GC7 B;  2I0R D;  2I0T D;  2AH1 D;  2IAA B;  2MAD L;  2I0S D;  3SVW C;  2AGY D;  4L1Q C;  4FA9 C;  3L4O C;  3SWS C;  1MDA L;  3RLM C;  1MG3 B;  3SJL C;  2J55 L;  3PXS C;  2OK6 D;  4O1Q C;  4FB1 C;  4K3I C;  4L3H C;  3SLE C;  2OIZ D;  1MAE L;  4FAN C;  3PXW C;  2HKR D;  4FA4 C;  4FAV C;  1MAF L;  3SXT C;  2J56 L;  2Q7Q D;  3ORV C;  4L3G C;  2AGX D;  2HJB D;  2OJY D;  3L4M C;  2HKM D;  2J57 K;  2IUV D;  2MTA L;  2AGW D;  2H47 B;  2AGL D;  3C75 L;  2H3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...