2MADL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
124
structure length
123
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
source organism Paracoccus versutus
molecule tags Oxidoreductase(chnh2(d)-deaminating)
total genus 29
structure length 123
sequence length 124
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2madL00
1MAEL 3PXWC 4FAVC 2OK4D 1MAFL 2IUPD 2OIZD 2AGWD 2AGZD 4FB1C 4FA4C 4K3IC 3SLEC 2I0SD 3SWSC 4FANC 4L3GC 2AH0D 1MG2B 3C75L 2AGXD 2AGYD 2IAAB 2H47B 3SVWC 2AGLD 2OJYD 2IUVD 3RMZC 3SJLC 3PXSC 2HXCD 3SXTC 2AH1D 2Q7QD 2I0RD 2IURD 2HKRD 2MADL 2J55L 1MDAL 2HJBD 3PXTC 4Y5RC 1MG3B 3L4MC 4L3HC 3RLMC 2GC4B 2I0TD 4O1QC 4FA9C 2HJ4D 3RN1C 2HKMD 2J56L 2J57K 4FA5C 2BBKL 2GC7B 2OK6D 2MTAL 4L1QC 3ORVC 4FA1C 3RN0C 2IUQD 2H3XB 3L4OC
chains in the Genus database with same CATH superfamily
1MAEL 3PXWC 4FAVC 2OK4D 1MAFL 2IUPD 2OIZD 2AGWD 2AGZD 4FB1C 4FA4C 4K3IC 3SLEC 2I0SD 3SWSC 4FANC 4L3GC 2AH0D 1MG2B 3C75L 2AGXD 2AGYD 2IAAB 2H47B 3SVWC 2AGLD 2OJYD 2IUVD 3RMZC 3SJLC 3PXSC 2HXCD 3SXTC 2AH1D 2Q7QD 2I0RD 2IURD 2HKRD 2MADL 2J55L 1MDAL 2HJBD 3PXTC 4Y5RC 1MG3B 3L4MC 4L3HC 3RLMC 2GC4B 2I0TD 4O1QC 4FA9C 2HJ4D 3RN1C 2HKMD 2J56L 2J57K 4FA5C 2BBKL 2GC7B 2OK6D 2MTAL 4L1QC 3ORVC 4FA1C 3RN0C 2IUQD 2H3XB 3L4OC
chains in the Genus database with same CATH topology
1MAEL 3PXWC 4FAVC 2OK4D 1MAFL 2IUPD 2OIZD 2AGWD 2AGZD 4FB1C 4FA4C 4K3IC 3SLEC 2I0SD 3SWSC 4FANC 4L3GC 2AH0D 1MG2B 3C75L 2AGXD 2AGYD 2IAAB 2H47B 3SVWC 2AGLD 2OJYD 2IUVD 3RMZC 3SJLC 3PXSC 2HXCD 3SXTC 2AH1D 2Q7QD 2I0RD 2IURD 2HKRD 2MADL 2J55L 1MDAL 2HJBD 3PXTC 4Y5RC 1MG3B 3L4MC 4L3HC 3RLMC 2GC4B 2I0TD 4O1QC 4FA9C 2HJ4D 3RN1C 2HKMD 2J56L 2J57K 4FA5C 2BBKL 2GC7B 2OK6D 2MTAL 4L1QC 3ORVC 4FA1C 3RN0C 2IUQD 2H3XB 3L4OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAE L;  3PXW C;  4FAV C;  2OK4 D;  1MAF L;  2IUP D;  2OIZ D;  2AGW D;  2AGZ D;  4FB1 C;  4FA4 C;  4K3I C;  3SLE C;  2I0S D;  3SWS C;  4FAN C;  4L3G C;  2AH0 D;  1MG2 B;  3C75 L;  2AGX D;  2AGY D;  2IAA B;  2H47 B;  3SVW C;  2AGL D;  2OJY D;  2IUV D;  3RMZ C;  3SJL C;  3PXS C;  2HXC D;  3SXT C;  2AH1 D;  2Q7Q D;  2I0R D;  2IUR D;  2HKR D;  2MAD L;  2J55 L;  1MDA L;  2HJB D;  3PXT C;  4Y5R C;  1MG3 B;  3L4M C;  4L3H C;  3RLM C;  2GC4 B;  2I0T D;  4O1Q C;  4FA9 C;  2HJ4 D;  3RN1 C;  2HKM D;  2J56 L;  2J57 K;  4FA5 C;  2BBK L;  2GC7 B;  2OK6 D;  2MTA L;  4L1Q C;  3ORV C;  4FA1 C;  3RN0 C;  2IUQ D;  2H3X B;  3L4O C; 
#chains in the Genus database with same CATH topology
 1MAE L;  3PXW C;  4FAV C;  2OK4 D;  1MAF L;  2IUP D;  2OIZ D;  2AGW D;  2AGZ D;  4FB1 C;  4FA4 C;  4K3I C;  3SLE C;  2I0S D;  3SWS C;  4FAN C;  4L3G C;  2AH0 D;  1MG2 B;  3C75 L;  2AGX D;  2AGY D;  2IAA B;  2H47 B;  3SVW C;  2AGL D;  2OJY D;  2IUV D;  3RMZ C;  3SJL C;  3PXS C;  2HXC D;  3SXT C;  2AH1 D;  2Q7Q D;  2I0R D;  2IUR D;  2HKR D;  2MAD L;  2J55 L;  1MDA L;  2HJB D;  3PXT C;  4Y5R C;  1MG3 B;  3L4M C;  4L3H C;  3RLM C;  2GC4 B;  2I0T D;  4O1Q C;  4FA9 C;  2HJ4 D;  3RN1 C;  2HKM D;  2J56 L;  2J57 K;  4FA5 C;  2BBK L;  2GC7 B;  2OK6 D;  2MTA L;  4L1Q C;  3ORV C;  4FA1 C;  3RN0 C;  2IUQ D;  2H3X B;  3L4O C; 
#chains in the Genus database with same CATH homology
 1MAE L;  3PXW C;  4FAV C;  2OK4 D;  1MAF L;  2IUP D;  2OIZ D;  2AGW D;  2AGZ D;  4FB1 C;  4FA4 C;  4K3I C;  3SLE C;  2I0S D;  3SWS C;  4FAN C;  4L3G C;  2AH0 D;  1MG2 B;  3C75 L;  2AGX D;  2AGY D;  2IAA B;  2H47 B;  3SVW C;  2AGL D;  2OJY D;  2IUV D;  3RMZ C;  3SJL C;  3PXS C;  2HXC D;  3SXT C;  2AH1 D;  2Q7Q D;  2I0R D;  2IUR D;  2HKR D;  2MAD L;  2J55 L;  1MDA L;  2HJB D;  3PXT C;  4Y5R C;  1MG3 B;  3L4M C;  4L3H C;  3RLM C;  2GC4 B;  2I0T D;  4O1Q C;  4FA9 C;  2HJ4 D;  3RN1 C;  2HKM D;  2J56 L;  2J57 K;  4FA5 C;  2BBK L;  2GC7 B;  2OK6 D;  2MTA L;  4L1Q C;  3ORV C;  4FA1 C;  3RN0 C;  2IUQ D;  2H3X B;  3L4O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...