2MADL

The active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
124
structure length
123
Chain Sequence
VDPRAKWQPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(chnh2(d)-deaminating)
molecule keywords METHYLAMINE DEHYDROGENASE (LIGHT SUBUNIT)
publication title Active site structure of methylamine dehydrogenase: hydrazines identify C6 as the reactive site of the tryptophan-derived quinone cofactor.
pubmed doi rcsb
source organism Paracoccus versutus
total genus 29
structure length 123
sequence length 124
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1992-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2madL00
2J55L 3RLMC 3SVWC 2AGYD 2H47B 4FAVC 4L1QC 2OJYD 2HKRD 4FA5C 2GC4B 2MADL 2IURD 4FANC 3RN1C 2IAAB 3L4OC 4O1QC 3PXSC 2MTAL 1MG2B 2AH0D 1MDAL 2IUQD 2GC7B 3ORVC 1MAFL 1MG3B 2HJBD 2H3XB 2J56L 3RMZC 3SWSC 2I0TD 4Y5RC 2Q7QD 2AGXD 2AGWD 2HJ4D 2IUPD 2J57K 3PXTC 3L4MC 4L3GC 3C75L 3RN0C 4FA1C 2HKMD 3PXWC 2BBKL 2HXCD 2AGZD 4K3IC 4FB1C 2OIZD 4FA4C 4FA9C 2IUVD 1MAEL 2AGLD 2I0SD 2OK6D 3SLEC 3SXTC 4L3HC 2I0RD 2AH1D 2OK4D 3SJLC
chains in the Genus database with same CATH superfamily
2J55L 3RLMC 3SVWC 2AGYD 2H47B 4FAVC 4L1QC 2OJYD 2HKRD 4FA5C 2GC4B 2MADL 2IURD 4FANC 3RN1C 2IAAB 3L4OC 4O1QC 3PXSC 2MTAL 1MG2B 2AH0D 1MDAL 2IUQD 2GC7B 3ORVC 1MAFL 1MG3B 2HJBD 2H3XB 2J56L 3RMZC 3SWSC 2I0TD 4Y5RC 2Q7QD 2AGXD 2AGWD 2HJ4D 2IUPD 2J57K 3PXTC 3L4MC 4L3GC 3C75L 3RN0C 4FA1C 2HKMD 3PXWC 2BBKL 2HXCD 2AGZD 4K3IC 4FB1C 2OIZD 4FA4C 4FA9C 2IUVD 1MAEL 2AGLD 2I0SD 2OK6D 3SLEC 3SXTC 4L3HC 2I0RD 2AH1D 2OK4D 3SJLC
chains in the Genus database with same CATH topology
2J55L 3RLMC 3SVWC 2AGYD 2H47B 4FAVC 4L1QC 2OJYD 2HKRD 4FA5C 2GC4B 2MADL 2IURD 4FANC 3RN1C 2IAAB 3L4OC 4O1QC 3PXSC 2MTAL 1MG2B 2AH0D 1MDAL 2IUQD 2GC7B 3ORVC 1MAFL 1MG3B 2HJBD 2H3XB 2J56L 3RMZC 3SWSC 2I0TD 4Y5RC 2Q7QD 2AGXD 2AGWD 2HJ4D 2IUPD 2J57K 3PXTC 3L4MC 4L3GC 3C75L 3RN0C 4FA1C 2HKMD 3PXWC 2BBKL 2HXCD 2AGZD 4K3IC 4FB1C 2OIZD 4FA4C 4FA9C 2IUVD 1MAEL 2AGLD 2I0SD 2OK6D 3SLEC 3SXTC 4L3HC 2I0RD 2AH1D 2OK4D 3SJLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J55 L;  3RLM C;  3SVW C;  2AGY D;  2H47 B;  4FAV C;  4L1Q C;  2OJY D;  2HKR D;  4FA5 C;  2GC4 B;  2MAD L;  2IUR D;  4FAN C;  3RN1 C;  2IAA B;  3L4O C;  4O1Q C;  3PXS C;  2MTA L;  1MG2 B;  2AH0 D;  1MDA L;  2IUQ D;  2GC7 B;  3ORV C;  1MAF L;  1MG3 B;  2HJB D;  2H3X B;  2J56 L;  3RMZ C;  3SWS C;  2I0T D;  4Y5R C;  2Q7Q D;  2AGX D;  2AGW D;  2HJ4 D;  2IUP D;  2J57 K;  3PXT C;  3L4M C;  4L3G C;  3C75 L;  3RN0 C;  4FA1 C;  2HKM D;  3PXW C;  2BBK L;  2HXC D;  2AGZ D;  4K3I C;  4FB1 C;  2OIZ D;  4FA4 C;  4FA9 C;  2IUV D;  1MAE L;  2AGL D;  2I0S D;  2OK6 D;  3SLE C;  3SXT C;  4L3H C;  2I0R D;  2AH1 D;  2OK4 D;  3SJL C; 
#chains in the Genus database with same CATH topology
 2J55 L;  3RLM C;  3SVW C;  2AGY D;  2H47 B;  4FAV C;  4L1Q C;  2OJY D;  2HKR D;  4FA5 C;  2GC4 B;  2MAD L;  2IUR D;  4FAN C;  3RN1 C;  2IAA B;  3L4O C;  4O1Q C;  3PXS C;  2MTA L;  1MG2 B;  2AH0 D;  1MDA L;  2IUQ D;  2GC7 B;  3ORV C;  1MAF L;  1MG3 B;  2HJB D;  2H3X B;  2J56 L;  3RMZ C;  3SWS C;  2I0T D;  4Y5R C;  2Q7Q D;  2AGX D;  2AGW D;  2HJ4 D;  2IUP D;  2J57 K;  3PXT C;  3L4M C;  4L3G C;  3C75 L;  3RN0 C;  4FA1 C;  2HKM D;  3PXW C;  2BBK L;  2HXC D;  2AGZ D;  4K3I C;  4FB1 C;  2OIZ D;  4FA4 C;  4FA9 C;  2IUV D;  1MAE L;  2AGL D;  2I0S D;  2OK6 D;  3SLE C;  3SXT C;  4L3H C;  2I0R D;  2AH1 D;  2OK4 D;  3SJL C; 
#chains in the Genus database with same CATH homology
 2J55 L;  3RLM C;  3SVW C;  2AGY D;  2H47 B;  4FAV C;  4L1Q C;  2OJY D;  2HKR D;  4FA5 C;  2GC4 B;  2MAD L;  2IUR D;  4FAN C;  3RN1 C;  2IAA B;  3L4O C;  4O1Q C;  3PXS C;  2MTA L;  1MG2 B;  2AH0 D;  1MDA L;  2IUQ D;  2GC7 B;  3ORV C;  1MAF L;  1MG3 B;  2HJB D;  2H3X B;  2J56 L;  3RMZ C;  3SWS C;  2I0T D;  4Y5R C;  2Q7Q D;  2AGX D;  2AGW D;  2HJ4 D;  2IUP D;  2J57 K;  3PXT C;  3L4M C;  4L3G C;  3C75 L;  3RN0 C;  4FA1 C;  2HKM D;  3PXW C;  2BBK L;  2HXC D;  2AGZ D;  4K3I C;  4FB1 C;  2OIZ D;  4FA4 C;  4FA9 C;  2IUV D;  1MAE L;  2AGL D;  2I0S D;  2OK6 D;  3SLE C;  3SXT C;  4L3H C;  2I0R D;  2AH1 D;  2OK4 D;  3SJL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...