4FA4C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 10 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa4C00
2OK4D 2AGWD 2IUVD 3SJLC 3SVWC 2IAAB 3PXTC 3RN0C 2BBKL 2I0RD 4FA1C 4FANC 3SWSC 4Y5RC 2AGYD 2HKMD 3L4MC 3RLMC 2J55L 2J57K 2HJBD 2OIZD 2GC7B 3C75L 4FA4C 2HJ4D 2IUPD 4FAVC 4K3IC 1MDAL 2OK6D 2Q7QD 4L3HC 3ORVC 2I0TD 1MG3B 2IUQD 2I0SD 3RMZC 3RN1C 4L1QC 4FA9C 2AH1D 2GC4B 2HKRD 2AH0D 2J56L 2AGZD 2AGXD 2MADL 3L4OC 3SXTC 1MAFL 2IURD 4FB1C 4FA5C 2HXCD 2OJYD 4L3GC 2H47B 1MG2B 3PXWC 1MAEL 3PXSC 3SLEC 2H3XB 2AGLD 4O1QC 2MTAL
chains in the Genus database with same CATH superfamily
2OK4D 2AGWD 2IUVD 3SJLC 3SVWC 2IAAB 3PXTC 3RN0C 2BBKL 2I0RD 4FA1C 4FANC 3SWSC 4Y5RC 2AGYD 2HKMD 3L4MC 3RLMC 2J55L 2J57K 2HJBD 2OIZD 2GC7B 3C75L 4FA4C 2HJ4D 2IUPD 4FAVC 4K3IC 1MDAL 2OK6D 2Q7QD 4L3HC 3ORVC 2I0TD 1MG3B 2IUQD 2I0SD 3RMZC 3RN1C 4L1QC 4FA9C 2AH1D 2GC4B 2HKRD 2AH0D 2J56L 2AGZD 2AGXD 2MADL 3L4OC 3SXTC 1MAFL 2IURD 4FB1C 4FA5C 2HXCD 2OJYD 4L3GC 2H47B 1MG2B 3PXWC 1MAEL 3PXSC 3SLEC 2H3XB 2AGLD 4O1QC 2MTAL
chains in the Genus database with same CATH topology
2OK4D 2AGWD 2IUVD 3SJLC 3SVWC 2IAAB 3PXTC 3RN0C 2BBKL 2I0RD 4FA1C 4FANC 3SWSC 4Y5RC 2AGYD 2HKMD 3L4MC 3RLMC 2J55L 2J57K 2HJBD 2OIZD 2GC7B 3C75L 4FA4C 2HJ4D 2IUPD 4FAVC 4K3IC 1MDAL 2OK6D 2Q7QD 4L3HC 3ORVC 2I0TD 1MG3B 2IUQD 2I0SD 3RMZC 3RN1C 4L1QC 4FA9C 2AH1D 2GC4B 2HKRD 2AH0D 2J56L 2AGZD 2AGXD 2MADL 3L4OC 3SXTC 1MAFL 2IURD 4FB1C 4FA5C 2HXCD 2OJYD 4L3GC 2H47B 1MG2B 3PXWC 1MAEL 3PXSC 3SLEC 2H3XB 2AGLD 4O1QC 2MTAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK4 D;  2AGW D;  2IUV D;  3SJL C;  3SVW C;  2IAA B;  3PXT C;  3RN0 C;  2BBK L;  2I0R D;  4FA1 C;  4FAN C;  3SWS C;  4Y5R C;  2AGY D;  2HKM D;  3L4M C;  3RLM C;  2J55 L;  2J57 K;  2HJB D;  2OIZ D;  2GC7 B;  3C75 L;  4FA4 C;  2HJ4 D;  2IUP D;  4FAV C;  4K3I C;  1MDA L;  2OK6 D;  2Q7Q D;  4L3H C;  3ORV C;  2I0T D;  1MG3 B;  2IUQ D;  2I0S D;  3RMZ C;  3RN1 C;  4L1Q C;  4FA9 C;  2AH1 D;  2GC4 B;  2HKR D;  2AH0 D;  2J56 L;  2AGZ D;  2AGX D;  2MAD L;  3L4O C;  3SXT C;  1MAF L;  2IUR D;  4FB1 C;  4FA5 C;  2HXC D;  2OJY D;  4L3G C;  2H47 B;  1MG2 B;  3PXW C;  1MAE L;  3PXS C;  3SLE C;  2H3X B;  2AGL D;  4O1Q C;  2MTA L; 
#chains in the Genus database with same CATH topology
 2OK4 D;  2AGW D;  2IUV D;  3SJL C;  3SVW C;  2IAA B;  3PXT C;  3RN0 C;  2BBK L;  2I0R D;  4FA1 C;  4FAN C;  3SWS C;  4Y5R C;  2AGY D;  2HKM D;  3L4M C;  3RLM C;  2J55 L;  2J57 K;  2HJB D;  2OIZ D;  2GC7 B;  3C75 L;  4FA4 C;  2HJ4 D;  2IUP D;  4FAV C;  4K3I C;  1MDA L;  2OK6 D;  2Q7Q D;  4L3H C;  3ORV C;  2I0T D;  1MG3 B;  2IUQ D;  2I0S D;  3RMZ C;  3RN1 C;  4L1Q C;  4FA9 C;  2AH1 D;  2GC4 B;  2HKR D;  2AH0 D;  2J56 L;  2AGZ D;  2AGX D;  2MAD L;  3L4O C;  3SXT C;  1MAF L;  2IUR D;  4FB1 C;  4FA5 C;  2HXC D;  2OJY D;  4L3G C;  2H47 B;  1MG2 B;  3PXW C;  1MAE L;  3PXS C;  3SLE C;  2H3X B;  2AGL D;  4O1Q C;  2MTA L; 
#chains in the Genus database with same CATH homology
 2OK4 D;  2AGW D;  2IUV D;  3SJL C;  3SVW C;  2IAA B;  3PXT C;  3RN0 C;  2BBK L;  2I0R D;  4FA1 C;  4FAN C;  3SWS C;  4Y5R C;  2AGY D;  2HKM D;  3L4M C;  3RLM C;  2J55 L;  2J57 K;  2HJB D;  2OIZ D;  2GC7 B;  3C75 L;  4FA4 C;  2HJ4 D;  2IUP D;  4FAV C;  4K3I C;  1MDA L;  2OK6 D;  2Q7Q D;  4L3H C;  3ORV C;  2I0T D;  1MG3 B;  2IUQ D;  2I0S D;  3RMZ C;  3RN1 C;  4L1Q C;  4FA9 C;  2AH1 D;  2GC4 B;  2HKR D;  2AH0 D;  2J56 L;  2AGZ D;  2AGX D;  2MAD L;  3L4O C;  3SXT C;  1MAF L;  2IUR D;  4FB1 C;  4FA5 C;  2HXC D;  2OJY D;  4L3G C;  2H47 B;  1MG2 B;  3PXW C;  1MAE L;  3PXS C;  3SLE C;  2H3X B;  2AGL D;  4O1Q C;  2MTA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...