4FA4C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 10 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
130
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa4C00
2I0TD 2H47B 2IURD 2IUVD 4FAVC 2OJYD 4O1QC 2OK6D 2IUPD 2J57K 4L3GC 1MG2B 2J56L 3ORVC 1MAFL 3PXWC 3PXTC 2AH0D 2BBKL 2GC7B 1MG3B 2HJBD 2HJ4D 2HKRD 2IAAB 4K3IC 3SLEC 4FANC 4FA9C 3SVWC 3L4OC 3RLMC 4L1QC 2AGYD 2AH1D 2AGLD 2Q7QD 3C75L 3RN1C 2GC4B 4Y5RC 1MDAL 3SXTC 3RN0C 3SWSC 2HXCD 3RMZC 2I0SD 2OIZD 2I0RD 4FB1C 2H3XB 2IUQD 2MADL 2AGZD 2AGXD 3SJLC 1MAEL 4FA5C 4FA4C 2HKMD 2OK4D 3L4MC 3PXSC 4L3HC 2MTAL 4FA1C 2AGWD 2J55L
chains in the Genus database with same CATH superfamily
2I0TD 2H47B 2IURD 2IUVD 4FAVC 2OJYD 4O1QC 2OK6D 2IUPD 2J57K 4L3GC 1MG2B 2J56L 3ORVC 1MAFL 3PXWC 3PXTC 2AH0D 2BBKL 2GC7B 1MG3B 2HJBD 2HJ4D 2HKRD 2IAAB 4K3IC 3SLEC 4FANC 4FA9C 3SVWC 3L4OC 3RLMC 4L1QC 2AGYD 2AH1D 2AGLD 2Q7QD 3C75L 3RN1C 2GC4B 4Y5RC 1MDAL 3SXTC 3RN0C 3SWSC 2HXCD 3RMZC 2I0SD 2OIZD 2I0RD 4FB1C 2H3XB 2IUQD 2MADL 2AGZD 2AGXD 3SJLC 1MAEL 4FA5C 4FA4C 2HKMD 2OK4D 3L4MC 3PXSC 4L3HC 2MTAL 4FA1C 2AGWD 2J55L
chains in the Genus database with same CATH topology
2I0TD 2H47B 2IURD 2IUVD 4FAVC 2OJYD 4O1QC 2OK6D 2IUPD 2J57K 4L3GC 1MG2B 2J56L 3ORVC 1MAFL 3PXWC 3PXTC 2AH0D 2BBKL 2GC7B 1MG3B 2HJBD 2HJ4D 2HKRD 2IAAB 4K3IC 3SLEC 4FANC 4FA9C 3SVWC 3L4OC 3RLMC 4L1QC 2AGYD 2AH1D 2AGLD 2Q7QD 3C75L 3RN1C 2GC4B 4Y5RC 1MDAL 3SXTC 3RN0C 3SWSC 2HXCD 3RMZC 2I0SD 2OIZD 2I0RD 4FB1C 2H3XB 2IUQD 2MADL 2AGZD 2AGXD 3SJLC 1MAEL 4FA5C 4FA4C 2HKMD 2OK4D 3L4MC 3PXSC 4L3HC 2MTAL 4FA1C 2AGWD 2J55L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0T D;  2H47 B;  2IUR D;  2IUV D;  4FAV C;  2OJY D;  4O1Q C;  2OK6 D;  2IUP D;  2J57 K;  4L3G C;  1MG2 B;  2J56 L;  3ORV C;  1MAF L;  3PXW C;  3PXT C;  2AH0 D;  2BBK L;  2GC7 B;  1MG3 B;  2HJB D;  2HJ4 D;  2HKR D;  2IAA B;  4K3I C;  3SLE C;  4FAN C;  4FA9 C;  3SVW C;  3L4O C;  3RLM C;  4L1Q C;  2AGY D;  2AH1 D;  2AGL D;  2Q7Q D;  3C75 L;  3RN1 C;  2GC4 B;  4Y5R C;  1MDA L;  3SXT C;  3RN0 C;  3SWS C;  2HXC D;  3RMZ C;  2I0S D;  2OIZ D;  2I0R D;  4FB1 C;  2H3X B;  2IUQ D;  2MAD L;  2AGZ D;  2AGX D;  3SJL C;  1MAE L;  4FA5 C;  4FA4 C;  2HKM D;  2OK4 D;  3L4M C;  3PXS C;  4L3H C;  2MTA L;  4FA1 C;  2AGW D;  2J55 L; 
#chains in the Genus database with same CATH topology
 2I0T D;  2H47 B;  2IUR D;  2IUV D;  4FAV C;  2OJY D;  4O1Q C;  2OK6 D;  2IUP D;  2J57 K;  4L3G C;  1MG2 B;  2J56 L;  3ORV C;  1MAF L;  3PXW C;  3PXT C;  2AH0 D;  2BBK L;  2GC7 B;  1MG3 B;  2HJB D;  2HJ4 D;  2HKR D;  2IAA B;  4K3I C;  3SLE C;  4FAN C;  4FA9 C;  3SVW C;  3L4O C;  3RLM C;  4L1Q C;  2AGY D;  2AH1 D;  2AGL D;  2Q7Q D;  3C75 L;  3RN1 C;  2GC4 B;  4Y5R C;  1MDA L;  3SXT C;  3RN0 C;  3SWS C;  2HXC D;  3RMZ C;  2I0S D;  2OIZ D;  2I0R D;  4FB1 C;  2H3X B;  2IUQ D;  2MAD L;  2AGZ D;  2AGX D;  3SJL C;  1MAE L;  4FA5 C;  4FA4 C;  2HKM D;  2OK4 D;  3L4M C;  3PXS C;  4L3H C;  2MTA L;  4FA1 C;  2AGW D;  2J55 L; 
#chains in the Genus database with same CATH homology
 2I0T D;  2H47 B;  2IUR D;  2IUV D;  4FAV C;  2OJY D;  4O1Q C;  2OK6 D;  2IUP D;  2J57 K;  4L3G C;  1MG2 B;  2J56 L;  3ORV C;  1MAF L;  3PXW C;  3PXT C;  2AH0 D;  2BBK L;  2GC7 B;  1MG3 B;  2HJB D;  2HJ4 D;  2HKR D;  2IAA B;  4K3I C;  3SLE C;  4FAN C;  4FA9 C;  3SVW C;  3L4O C;  3RLM C;  4L1Q C;  2AGY D;  2AH1 D;  2AGL D;  2Q7Q D;  3C75 L;  3RN1 C;  2GC4 B;  4Y5R C;  1MDA L;  3SXT C;  3RN0 C;  3SWS C;  2HXC D;  3RMZ C;  2I0S D;  2OIZ D;  2I0R D;  4FB1 C;  2H3X B;  2IUQ D;  2MAD L;  2AGZ D;  2AGX D;  3SJL C;  1MAE L;  4FA5 C;  4FA4 C;  2HKM D;  2OK4 D;  3L4M C;  3PXS C;  4L3H C;  2MTA L;  4FA1 C;  2AGW D;  2J55 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...