4FA4C

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 10 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
130
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 31
structure length 130
sequence length 131
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fa4C00
4FA5C 4O1QC 4FA1C 3SWSC 2AGWD 2OIZD 4L1QC 4FB1C 3SXTC 2I0RD 2IUVD 2IAAB 3L4OC 3RLMC 2AH1D 2IURD 2AGXD 1MAFL 2IUPD 2J56L 2MADL 4FA4C 2IUQD 4FAVC 3RMZC 1MDAL 2HJBD 2HKMD 3PXWC 2AGZD 3L4MC 2OK4D 3SJLC 2GC4B 3SVWC 3PXSC 3ORVC 2MTAL 2HJ4D 1MG2B 4Y5RC 2AH0D 3RN0C 4FANC 3RN1C 1MAEL 2HXCD 3PXTC 2AGYD 2H47B 4L3GC 2AGLD 2I0TD 2I0SD 4K3IC 2HKRD 2GC7B 2Q7QD 4L3HC 4FA9C 3SLEC 2OK6D 2J57K 2OJYD 1MG3B 2H3XB 2J55L 3C75L 2BBKL
chains in the Genus database with same CATH superfamily
4FA5C 4O1QC 4FA1C 3SWSC 2AGWD 2OIZD 4L1QC 4FB1C 3SXTC 2I0RD 2IUVD 2IAAB 3L4OC 3RLMC 2AH1D 2IURD 2AGXD 1MAFL 2IUPD 2J56L 2MADL 4FA4C 2IUQD 4FAVC 3RMZC 1MDAL 2HJBD 2HKMD 3PXWC 2AGZD 3L4MC 2OK4D 3SJLC 2GC4B 3SVWC 3PXSC 3ORVC 2MTAL 2HJ4D 1MG2B 4Y5RC 2AH0D 3RN0C 4FANC 3RN1C 1MAEL 2HXCD 3PXTC 2AGYD 2H47B 4L3GC 2AGLD 2I0TD 2I0SD 4K3IC 2HKRD 2GC7B 2Q7QD 4L3HC 4FA9C 3SLEC 2OK6D 2J57K 2OJYD 1MG3B 2H3XB 2J55L 3C75L 2BBKL
chains in the Genus database with same CATH topology
4FA5C 4O1QC 4FA1C 3SWSC 2AGWD 2OIZD 4L1QC 4FB1C 3SXTC 2I0RD 2IUVD 2IAAB 3L4OC 3RLMC 2AH1D 2IURD 2AGXD 1MAFL 2IUPD 2J56L 2MADL 4FA4C 2IUQD 4FAVC 3RMZC 1MDAL 2HJBD 2HKMD 3PXWC 2AGZD 3L4MC 2OK4D 3SJLC 2GC4B 3SVWC 3PXSC 3ORVC 2MTAL 2HJ4D 1MG2B 4Y5RC 2AH0D 3RN0C 4FANC 3RN1C 1MAEL 2HXCD 3PXTC 2AGYD 2H47B 4L3GC 2AGLD 2I0TD 2I0SD 4K3IC 2HKRD 2GC7B 2Q7QD 4L3HC 4FA9C 3SLEC 2OK6D 2J57K 2OJYD 1MG3B 2H3XB 2J55L 3C75L 2BBKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA5 C;  4O1Q C;  4FA1 C;  3SWS C;  2AGW D;  2OIZ D;  4L1Q C;  4FB1 C;  3SXT C;  2I0R D;  2IUV D;  2IAA B;  3L4O C;  3RLM C;  2AH1 D;  2IUR D;  2AGX D;  1MAF L;  2IUP D;  2J56 L;  2MAD L;  4FA4 C;  2IUQ D;  4FAV C;  3RMZ C;  1MDA L;  2HJB D;  2HKM D;  3PXW C;  2AGZ D;  3L4M C;  2OK4 D;  3SJL C;  2GC4 B;  3SVW C;  3PXS C;  3ORV C;  2MTA L;  2HJ4 D;  1MG2 B;  4Y5R C;  2AH0 D;  3RN0 C;  4FAN C;  3RN1 C;  1MAE L;  2HXC D;  3PXT C;  2AGY D;  2H47 B;  4L3G C;  2AGL D;  2I0T D;  2I0S D;  4K3I C;  2HKR D;  2GC7 B;  2Q7Q D;  4L3H C;  4FA9 C;  3SLE C;  2OK6 D;  2J57 K;  2OJY D;  1MG3 B;  2H3X B;  2J55 L;  3C75 L;  2BBK L; 
#chains in the Genus database with same CATH topology
 4FA5 C;  4O1Q C;  4FA1 C;  3SWS C;  2AGW D;  2OIZ D;  4L1Q C;  4FB1 C;  3SXT C;  2I0R D;  2IUV D;  2IAA B;  3L4O C;  3RLM C;  2AH1 D;  2IUR D;  2AGX D;  1MAF L;  2IUP D;  2J56 L;  2MAD L;  4FA4 C;  2IUQ D;  4FAV C;  3RMZ C;  1MDA L;  2HJB D;  2HKM D;  3PXW C;  2AGZ D;  3L4M C;  2OK4 D;  3SJL C;  2GC4 B;  3SVW C;  3PXS C;  3ORV C;  2MTA L;  2HJ4 D;  1MG2 B;  4Y5R C;  2AH0 D;  3RN0 C;  4FAN C;  3RN1 C;  1MAE L;  2HXC D;  3PXT C;  2AGY D;  2H47 B;  4L3G C;  2AGL D;  2I0T D;  2I0S D;  4K3I C;  2HKR D;  2GC7 B;  2Q7Q D;  4L3H C;  4FA9 C;  3SLE C;  2OK6 D;  2J57 K;  2OJY D;  1MG3 B;  2H3X B;  2J55 L;  3C75 L;  2BBK L; 
#chains in the Genus database with same CATH homology
 4FA5 C;  4O1Q C;  4FA1 C;  3SWS C;  2AGW D;  2OIZ D;  4L1Q C;  4FB1 C;  3SXT C;  2I0R D;  2IUV D;  2IAA B;  3L4O C;  3RLM C;  2AH1 D;  2IUR D;  2AGX D;  1MAF L;  2IUP D;  2J56 L;  2MAD L;  4FA4 C;  2IUQ D;  4FAV C;  3RMZ C;  1MDA L;  2HJB D;  2HKM D;  3PXW C;  2AGZ D;  3L4M C;  2OK4 D;  3SJL C;  2GC4 B;  3SVW C;  3PXS C;  3ORV C;  2MTA L;  2HJ4 D;  1MG2 B;  4Y5R C;  2AH0 D;  3RN0 C;  4FAN C;  3RN1 C;  1MAE L;  2HXC D;  3PXT C;  2AGY D;  2H47 B;  4L3G C;  2AGL D;  2I0T D;  2I0S D;  4K3I C;  2HKR D;  2GC7 B;  2Q7Q D;  4L3H C;  4FA9 C;  3SLE C;  2OK6 D;  2J57 K;  2OJY D;  1MG3 B;  2H3X B;  2J55 L;  3C75 L;  2BBK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...