2Q7QD

Crystal structure of alcaligenes faecalis aadh in complex with p-chlorobenzylamine.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aralkylamine dehydrogenase light chain
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 24
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2q7qD00
2OK4D 3L4MC 1MDAL 3L4OC 2J55L 3RMZC 2IURD 4K3IC 4FB1C 2H47B 4FAVC 3RN1C 2BBKL 4L3HC 3RLMC 3C75L 3PXTC 2I0RD 2GC7B 2AGWD 3SJLC 4FANC 3ORVC 2AGLD 2HJBD 2IAAB 2AGYD 2OJYD 3PXSC 4FA4C 2IUPD 4FA1C 4FA9C 2AH1D 2MTAL 2HXCD 2HKMD 1MAEL 2IUVD 2MADL 1MG2B 2OK6D 2HKRD 3PXWC 2I0SD 2GC4B 3SWSC 2AGXD 3SLEC 3SVWC 2HJ4D 2AH0D 3RN0C 4Y5RC 4L3GC 2Q7QD 1MG3B 2J57K 2H3XB 4L1QC 2AGZD 1MAFL 3SXTC 2J56L 2OIZD 4FA5C 4O1QC 2IUQD 2I0TD
chains in the Genus database with same CATH superfamily
2OK4D 3L4MC 1MDAL 3L4OC 2J55L 3RMZC 2IURD 4K3IC 4FB1C 2H47B 4FAVC 3RN1C 2BBKL 4L3HC 3RLMC 3C75L 3PXTC 2I0RD 2GC7B 2AGWD 3SJLC 4FANC 3ORVC 2AGLD 2HJBD 2IAAB 2AGYD 2OJYD 3PXSC 4FA4C 2IUPD 4FA1C 4FA9C 2AH1D 2MTAL 2HXCD 2HKMD 1MAEL 2IUVD 2MADL 1MG2B 2OK6D 2HKRD 3PXWC 2I0SD 2GC4B 3SWSC 2AGXD 3SLEC 3SVWC 2HJ4D 2AH0D 3RN0C 4Y5RC 4L3GC 2Q7QD 1MG3B 2J57K 2H3XB 4L1QC 2AGZD 1MAFL 3SXTC 2J56L 2OIZD 4FA5C 4O1QC 2IUQD 2I0TD
chains in the Genus database with same CATH topology
2OK4D 3L4MC 1MDAL 3L4OC 2J55L 3RMZC 2IURD 4K3IC 4FB1C 2H47B 4FAVC 3RN1C 2BBKL 4L3HC 3RLMC 3C75L 3PXTC 2I0RD 2GC7B 2AGWD 3SJLC 4FANC 3ORVC 2AGLD 2HJBD 2IAAB 2AGYD 2OJYD 3PXSC 4FA4C 2IUPD 4FA1C 4FA9C 2AH1D 2MTAL 2HXCD 2HKMD 1MAEL 2IUVD 2MADL 1MG2B 2OK6D 2HKRD 3PXWC 2I0SD 2GC4B 3SWSC 2AGXD 3SLEC 3SVWC 2HJ4D 2AH0D 3RN0C 4Y5RC 4L3GC 2Q7QD 1MG3B 2J57K 2H3XB 4L1QC 2AGZD 1MAFL 3SXTC 2J56L 2OIZD 4FA5C 4O1QC 2IUQD 2I0TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK4 D;  3L4M C;  1MDA L;  3L4O C;  2J55 L;  3RMZ C;  2IUR D;  4K3I C;  4FB1 C;  2H47 B;  4FAV C;  3RN1 C;  2BBK L;  4L3H C;  3RLM C;  3C75 L;  3PXT C;  2I0R D;  2GC7 B;  2AGW D;  3SJL C;  4FAN C;  3ORV C;  2AGL D;  2HJB D;  2IAA B;  2AGY D;  2OJY D;  3PXS C;  4FA4 C;  2IUP D;  4FA1 C;  4FA9 C;  2AH1 D;  2MTA L;  2HXC D;  2HKM D;  1MAE L;  2IUV D;  2MAD L;  1MG2 B;  2OK6 D;  2HKR D;  3PXW C;  2I0S D;  2GC4 B;  3SWS C;  2AGX D;  3SLE C;  3SVW C;  2HJ4 D;  2AH0 D;  3RN0 C;  4Y5R C;  4L3G C;  2Q7Q D;  1MG3 B;  2J57 K;  2H3X B;  4L1Q C;  2AGZ D;  1MAF L;  3SXT C;  2J56 L;  2OIZ D;  4FA5 C;  4O1Q C;  2IUQ D;  2I0T D; 
#chains in the Genus database with same CATH topology
 2OK4 D;  3L4M C;  1MDA L;  3L4O C;  2J55 L;  3RMZ C;  2IUR D;  4K3I C;  4FB1 C;  2H47 B;  4FAV C;  3RN1 C;  2BBK L;  4L3H C;  3RLM C;  3C75 L;  3PXT C;  2I0R D;  2GC7 B;  2AGW D;  3SJL C;  4FAN C;  3ORV C;  2AGL D;  2HJB D;  2IAA B;  2AGY D;  2OJY D;  3PXS C;  4FA4 C;  2IUP D;  4FA1 C;  4FA9 C;  2AH1 D;  2MTA L;  2HXC D;  2HKM D;  1MAE L;  2IUV D;  2MAD L;  1MG2 B;  2OK6 D;  2HKR D;  3PXW C;  2I0S D;  2GC4 B;  3SWS C;  2AGX D;  3SLE C;  3SVW C;  2HJ4 D;  2AH0 D;  3RN0 C;  4Y5R C;  4L3G C;  2Q7Q D;  1MG3 B;  2J57 K;  2H3X B;  4L1Q C;  2AGZ D;  1MAF L;  3SXT C;  2J56 L;  2OIZ D;  4FA5 C;  4O1Q C;  2IUQ D;  2I0T D; 
#chains in the Genus database with same CATH homology
 2OK4 D;  3L4M C;  1MDA L;  3L4O C;  2J55 L;  3RMZ C;  2IUR D;  4K3I C;  4FB1 C;  2H47 B;  4FAV C;  3RN1 C;  2BBK L;  4L3H C;  3RLM C;  3C75 L;  3PXT C;  2I0R D;  2GC7 B;  2AGW D;  3SJL C;  4FAN C;  3ORV C;  2AGL D;  2HJB D;  2IAA B;  2AGY D;  2OJY D;  3PXS C;  4FA4 C;  2IUP D;  4FA1 C;  4FA9 C;  2AH1 D;  2MTA L;  2HXC D;  2HKM D;  1MAE L;  2IUV D;  2MAD L;  1MG2 B;  2OK6 D;  2HKR D;  3PXW C;  2I0S D;  2GC4 B;  3SWS C;  2AGX D;  3SLE C;  3SVW C;  2HJ4 D;  2AH0 D;  3RN0 C;  4Y5R C;  4L3G C;  2Q7Q D;  1MG3 B;  2J57 K;  2H3X B;  4L1Q C;  2AGZ D;  1MAF L;  3SXT C;  2J56 L;  2OIZ D;  4FA5 C;  4O1Q C;  2IUQ D;  2I0T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...