2Q7QD

Crystal structure of alcaligenes faecalis aadh in complex with p-chlorobenzylamine.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
Knots found
sequence length
109
structure length
108
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aralkylamine dehydrogenase light chain
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 24
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2q7qD00
2IUQD 2AGYD 4L3GC 2Q7QD 4O1QC 3SJLC 4FANC 3L4MC 2AGLD 4L1QC 2J57K 3SWSC 2H47B 3SVWC 4FB1C 4Y5RC 3PXTC 4FA5C 3RMZC 1MDAL 2J55L 1MG3B 2HKMD 2GC7B 4FA4C 2BBKL 2IAAB 4K3IC 2AH0D 2I0SD 2MADL 2OK6D 2OIZD 3PXSC 3RN0C 4FA9C 2OK4D 2H3XB 3RN1C 2I0TD 2HJBD 2OJYD 3SXTC 2MTAL 2AGZD 2HXCD 2AGWD 2AH1D 2IURD 3PXWC 2I0RD 2AGXD 2GC4B 1MAEL 2HKRD 4FA1C 2IUVD 4FAVC 3C75L 1MG2B 2HJ4D 2IUPD 4L3HC 3RLMC 3ORVC 3SLEC 2J56L 3L4OC 1MAFL
chains in the Genus database with same CATH superfamily
2IUQD 2AGYD 4L3GC 2Q7QD 4O1QC 3SJLC 4FANC 3L4MC 2AGLD 4L1QC 2J57K 3SWSC 2H47B 3SVWC 4FB1C 4Y5RC 3PXTC 4FA5C 3RMZC 1MDAL 2J55L 1MG3B 2HKMD 2GC7B 4FA4C 2BBKL 2IAAB 4K3IC 2AH0D 2I0SD 2MADL 2OK6D 2OIZD 3PXSC 3RN0C 4FA9C 2OK4D 2H3XB 3RN1C 2I0TD 2HJBD 2OJYD 3SXTC 2MTAL 2AGZD 2HXCD 2AGWD 2AH1D 2IURD 3PXWC 2I0RD 2AGXD 2GC4B 1MAEL 2HKRD 4FA1C 2IUVD 4FAVC 3C75L 1MG2B 2HJ4D 2IUPD 4L3HC 3RLMC 3ORVC 3SLEC 2J56L 3L4OC 1MAFL
chains in the Genus database with same CATH topology
2IUQD 2AGYD 4L3GC 2Q7QD 4O1QC 3SJLC 4FANC 3L4MC 2AGLD 4L1QC 2J57K 3SWSC 2H47B 3SVWC 4FB1C 4Y5RC 3PXTC 4FA5C 3RMZC 1MDAL 2J55L 1MG3B 2HKMD 2GC7B 4FA4C 2BBKL 2IAAB 4K3IC 2AH0D 2I0SD 2MADL 2OK6D 2OIZD 3PXSC 3RN0C 4FA9C 2OK4D 2H3XB 3RN1C 2I0TD 2HJBD 2OJYD 3SXTC 2MTAL 2AGZD 2HXCD 2AGWD 2AH1D 2IURD 3PXWC 2I0RD 2AGXD 2GC4B 1MAEL 2HKRD 4FA1C 2IUVD 4FAVC 3C75L 1MG2B 2HJ4D 2IUPD 4L3HC 3RLMC 3ORVC 3SLEC 2J56L 3L4OC 1MAFL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUQ D;  2AGY D;  4L3G C;  2Q7Q D;  4O1Q C;  3SJL C;  4FAN C;  3L4M C;  2AGL D;  4L1Q C;  2J57 K;  3SWS C;  2H47 B;  3SVW C;  4FB1 C;  4Y5R C;  3PXT C;  4FA5 C;  3RMZ C;  1MDA L;  2J55 L;  1MG3 B;  2HKM D;  2GC7 B;  4FA4 C;  2BBK L;  2IAA B;  4K3I C;  2AH0 D;  2I0S D;  2MAD L;  2OK6 D;  2OIZ D;  3PXS C;  3RN0 C;  4FA9 C;  2OK4 D;  2H3X B;  3RN1 C;  2I0T D;  2HJB D;  2OJY D;  3SXT C;  2MTA L;  2AGZ D;  2HXC D;  2AGW D;  2AH1 D;  2IUR D;  3PXW C;  2I0R D;  2AGX D;  2GC4 B;  1MAE L;  2HKR D;  4FA1 C;  2IUV D;  4FAV C;  3C75 L;  1MG2 B;  2HJ4 D;  2IUP D;  4L3H C;  3RLM C;  3ORV C;  3SLE C;  2J56 L;  3L4O C;  1MAF L; 
#chains in the Genus database with same CATH topology
 2IUQ D;  2AGY D;  4L3G C;  2Q7Q D;  4O1Q C;  3SJL C;  4FAN C;  3L4M C;  2AGL D;  4L1Q C;  2J57 K;  3SWS C;  2H47 B;  3SVW C;  4FB1 C;  4Y5R C;  3PXT C;  4FA5 C;  3RMZ C;  1MDA L;  2J55 L;  1MG3 B;  2HKM D;  2GC7 B;  4FA4 C;  2BBK L;  2IAA B;  4K3I C;  2AH0 D;  2I0S D;  2MAD L;  2OK6 D;  2OIZ D;  3PXS C;  3RN0 C;  4FA9 C;  2OK4 D;  2H3X B;  3RN1 C;  2I0T D;  2HJB D;  2OJY D;  3SXT C;  2MTA L;  2AGZ D;  2HXC D;  2AGW D;  2AH1 D;  2IUR D;  3PXW C;  2I0R D;  2AGX D;  2GC4 B;  1MAE L;  2HKR D;  4FA1 C;  2IUV D;  4FAV C;  3C75 L;  1MG2 B;  2HJ4 D;  2IUP D;  4L3H C;  3RLM C;  3ORV C;  3SLE C;  2J56 L;  3L4O C;  1MAF L; 
#chains in the Genus database with same CATH homology
 2IUQ D;  2AGY D;  4L3G C;  2Q7Q D;  4O1Q C;  3SJL C;  4FAN C;  3L4M C;  2AGL D;  4L1Q C;  2J57 K;  3SWS C;  2H47 B;  3SVW C;  4FB1 C;  4Y5R C;  3PXT C;  4FA5 C;  3RMZ C;  1MDA L;  2J55 L;  1MG3 B;  2HKM D;  2GC7 B;  4FA4 C;  2BBK L;  2IAA B;  4K3I C;  2AH0 D;  2I0S D;  2MAD L;  2OK6 D;  2OIZ D;  3PXS C;  3RN0 C;  4FA9 C;  2OK4 D;  2H3X B;  3RN1 C;  2I0T D;  2HJB D;  2OJY D;  3SXT C;  2MTA L;  2AGZ D;  2HXC D;  2AGW D;  2AH1 D;  2IUR D;  3PXW C;  2I0R D;  2AGX D;  2GC4 B;  1MAE L;  2HKR D;  4FA1 C;  2IUV D;  4FAV C;  3C75 L;  1MG2 B;  2HJ4 D;  2IUP D;  4L3H C;  3RLM C;  3ORV C;  3SLE C;  2J56 L;  3L4O C;  1MAF L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...