2Q7QD

Crystal structure of alcaligenes faecalis aadh in complex with p-chlorobenzylamine.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
Knots found
sequence length
109
structure length
108
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aralkylamine dehydrogenase light chain
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 24
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2q7qD00
4L3GC 2OK4D 2HKMD 4O1QC 2GC4B 4L3HC 1MAEL 2H47B 4K3IC 2IUVD 2MTAL 2OJYD 2I0RD 2AH1D 2J55L 2AGXD 3RN0C 3PXSC 3SLEC 4FAVC 2AH0D 1MDAL 2J57K 4FA1C 4FA9C 3SWSC 1MAFL 3RLMC 3ORVC 3RN1C 2Q7QD 3L4MC 4FB1C 2GC7B 4FANC 2IUQD 1MG3B 2I0TD 2MADL 2H3XB 3SJLC 2HKRD 2AGLD 3SVWC 4FA5C 3C75L 2I0SD 2IURD 3RMZC 3SXTC 2IUPD 3L4OC 2AGWD 4Y5RC 2OK6D 2BBKL 2HJBD 2HXCD 2IAAB 2AGYD 3PXTC 3PXWC 2OIZD 2HJ4D 2J56L 4FA4C 1MG2B 2AGZD 4L1QC
chains in the Genus database with same CATH superfamily
4L3GC 2OK4D 2HKMD 4O1QC 2GC4B 4L3HC 1MAEL 2H47B 4K3IC 2IUVD 2MTAL 2OJYD 2I0RD 2AH1D 2J55L 2AGXD 3RN0C 3PXSC 3SLEC 4FAVC 2AH0D 1MDAL 2J57K 4FA1C 4FA9C 3SWSC 1MAFL 3RLMC 3ORVC 3RN1C 2Q7QD 3L4MC 4FB1C 2GC7B 4FANC 2IUQD 1MG3B 2I0TD 2MADL 2H3XB 3SJLC 2HKRD 2AGLD 3SVWC 4FA5C 3C75L 2I0SD 2IURD 3RMZC 3SXTC 2IUPD 3L4OC 2AGWD 4Y5RC 2OK6D 2BBKL 2HJBD 2HXCD 2IAAB 2AGYD 3PXTC 3PXWC 2OIZD 2HJ4D 2J56L 4FA4C 1MG2B 2AGZD 4L1QC
chains in the Genus database with same CATH topology
4L3GC 2OK4D 2HKMD 4O1QC 2GC4B 4L3HC 1MAEL 2H47B 4K3IC 2IUVD 2MTAL 2OJYD 2I0RD 2AH1D 2J55L 2AGXD 3RN0C 3PXSC 3SLEC 4FAVC 2AH0D 1MDAL 2J57K 4FA1C 4FA9C 3SWSC 1MAFL 3RLMC 3ORVC 3RN1C 2Q7QD 3L4MC 4FB1C 2GC7B 4FANC 2IUQD 1MG3B 2I0TD 2MADL 2H3XB 3SJLC 2HKRD 2AGLD 3SVWC 4FA5C 3C75L 2I0SD 2IURD 3RMZC 3SXTC 2IUPD 3L4OC 2AGWD 4Y5RC 2OK6D 2BBKL 2HJBD 2HXCD 2IAAB 2AGYD 3PXTC 3PXWC 2OIZD 2HJ4D 2J56L 4FA4C 1MG2B 2AGZD 4L1QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3G C;  2OK4 D;  2HKM D;  4O1Q C;  2GC4 B;  4L3H C;  1MAE L;  2H47 B;  4K3I C;  2IUV D;  2MTA L;  2OJY D;  2I0R D;  2AH1 D;  2J55 L;  2AGX D;  3RN0 C;  3PXS C;  3SLE C;  4FAV C;  2AH0 D;  1MDA L;  2J57 K;  4FA1 C;  4FA9 C;  3SWS C;  1MAF L;  3RLM C;  3ORV C;  3RN1 C;  2Q7Q D;  3L4M C;  4FB1 C;  2GC7 B;  4FAN C;  2IUQ D;  1MG3 B;  2I0T D;  2MAD L;  2H3X B;  3SJL C;  2HKR D;  2AGL D;  3SVW C;  4FA5 C;  3C75 L;  2I0S D;  2IUR D;  3RMZ C;  3SXT C;  2IUP D;  3L4O C;  2AGW D;  4Y5R C;  2OK6 D;  2BBK L;  2HJB D;  2HXC D;  2IAA B;  2AGY D;  3PXT C;  3PXW C;  2OIZ D;  2HJ4 D;  2J56 L;  4FA4 C;  1MG2 B;  2AGZ D;  4L1Q C; 
#chains in the Genus database with same CATH topology
 4L3G C;  2OK4 D;  2HKM D;  4O1Q C;  2GC4 B;  4L3H C;  1MAE L;  2H47 B;  4K3I C;  2IUV D;  2MTA L;  2OJY D;  2I0R D;  2AH1 D;  2J55 L;  2AGX D;  3RN0 C;  3PXS C;  3SLE C;  4FAV C;  2AH0 D;  1MDA L;  2J57 K;  4FA1 C;  4FA9 C;  3SWS C;  1MAF L;  3RLM C;  3ORV C;  3RN1 C;  2Q7Q D;  3L4M C;  4FB1 C;  2GC7 B;  4FAN C;  2IUQ D;  1MG3 B;  2I0T D;  2MAD L;  2H3X B;  3SJL C;  2HKR D;  2AGL D;  3SVW C;  4FA5 C;  3C75 L;  2I0S D;  2IUR D;  3RMZ C;  3SXT C;  2IUP D;  3L4O C;  2AGW D;  4Y5R C;  2OK6 D;  2BBK L;  2HJB D;  2HXC D;  2IAA B;  2AGY D;  3PXT C;  3PXW C;  2OIZ D;  2HJ4 D;  2J56 L;  4FA4 C;  1MG2 B;  2AGZ D;  4L1Q C; 
#chains in the Genus database with same CATH homology
 4L3G C;  2OK4 D;  2HKM D;  4O1Q C;  2GC4 B;  4L3H C;  1MAE L;  2H47 B;  4K3I C;  2IUV D;  2MTA L;  2OJY D;  2I0R D;  2AH1 D;  2J55 L;  2AGX D;  3RN0 C;  3PXS C;  3SLE C;  4FAV C;  2AH0 D;  1MDA L;  2J57 K;  4FA1 C;  4FA9 C;  3SWS C;  1MAF L;  3RLM C;  3ORV C;  3RN1 C;  2Q7Q D;  3L4M C;  4FB1 C;  2GC7 B;  4FAN C;  2IUQ D;  1MG3 B;  2I0T D;  2MAD L;  2H3X B;  3SJL C;  2HKR D;  2AGL D;  3SVW C;  4FA5 C;  3C75 L;  2I0S D;  2IUR D;  3RMZ C;  3SXT C;  2IUP D;  3L4O C;  2AGW D;  4Y5R C;  2OK6 D;  2BBK L;  2HJB D;  2HXC D;  2IAA B;  2AGY D;  3PXT C;  3PXW C;  2OIZ D;  2HJ4 D;  2J56 L;  4FA4 C;  1MG2 B;  2AGZ D;  4L1Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...