The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
69
|
sequence length |
187
|
structure length |
187
|
Chain Sequence |
NRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGKAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSYSVIMLNTDLHNPNVRDKMGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPED
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor
pubmed doi rcsb |
| molecule keywords |
ADP-ribosylation factor 1
|
| molecule tags |
Protein transport/exchange factor
|
| source organism |
Bos taurus
|
| total genus |
69
|
| structure length |
187
|
| sequence length |
187
|
| ec nomenclature | |
| pdb deposition date | 2003-10-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| E | PF01369 | Sec7 | Sec7 domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Annexin V; domain 1 | Annexin V; domain 1 | ||
| Mainly Alpha | Orthogonal Bundle | Arf Nucleotide-binding Site Opener; domain 2 | Arf Nucleotide-binding Site Opener,domain 2 |
#chains in the Genus database with same CATH superfamily 4Z21 A; 4OIY A; 4JWL A; 3L8N A; 1BC9 A; 1RE0 B; 4C7P A; 1R8Q E; 1XT0 B; 1XSZ A; 3LTL A; 1PBV A; 1S9D E; 4L5M A; 4D7R A; 3SWV A; 1R8S E; 2R0D A; 1R8M E; 4JMI A; 4A4P A; 1KU1 A; 4JMO A; 2R09 A; 4C0A A; 4D7Q A; 4JXH A; #chains in the Genus database with same CATH topology 1A8A A; 2XO3 A; 2IE6 A; 1AEI A; 3SOH B; 1HVF A; 1QC7 A; 2RAN A; 1AVR A; 4JWL A; 1A8B A; 1HVD A; 1BO9 A; 1AOW A; 2HYV A; 1N42 A; 3ANY A; 3AO0 A; 1ANW A; 4D7R A; 1BC0 A; 2XO2 A; 3SWV A; 1AXN A; 2ZOC A; 1Q8D A; 3HJL A; 1ALA A; 1KU1 A; 4MDV A; 1MCX A; 2QEZ A; 2IE7 A; 4C0A A; 1YGM A; 1HVG A; 4X9P A; 2ZHJ A; 1W7B A; 1N44 A; 4KN7 X; 2ZHI A; 2H0K A; 3L8N A; 1AVH A; 3BRX A; 3USY A; 4L5M A; 1DM5 A; 2HYW A; 4JMI A; 1UPT B; 2OY9 A; 4EVF A; 1YJ0 A; 4JXH A; 1G5N A; 1R4A E; 4Q2S A; 4HRE A; 1BC3 A; 1LKV X; 1BCY A; 2Q4C A; 4KN4 X; 4KMU X; 4Z21 A; 2II2 A; 1XJL A; 1W3W A; 1BC1 A; 1BC9 A; 1RE0 B; 2H0M A; 1R8Q E; 3TW5 A; 1XSZ A; 3LTL A; 1PBV A; 1W45 A; 4FHR B; 1S9D E; 4JK1 X; 3ABQ A; 1YCN A; 3ABS A; 1R8S E; 2R0D A; 3ABO A; 4FQ0 C; 1M9I A; 4A4P A; 1SAV A; 2R09 A; 1ANN A; 4D7Q A; 1C1K A; 1BCW A; 1YII A; 4EVH A; 1AII A; 2VXG A; 1HVE A; 4OIY A; 3USW A; 4C7P A; 1XT0 B; 1N00 A; 1DK5 A; 1AVC A; 2K6X A; 1HAK A; 3AJC A; 1ANX A; 4MDU A; 1N41 A; 2HSN A; 1R8M E; 4JMO A; 1BCZ A; 3ABR A; 1I4A A; 2H0L A; 2IIC A; 2HYU A; 1HM6 A; #chains in the Genus database with same CATH homology 1LKV X; 4KN4 X; 4KMU X; 4KN7 X; 4Z21 A; 3SOH B; 1QC7 A; 4OIY A; 3L8N A; 4JWL A; 1BC9 A; 3USW A; 1RE0 B; 4C7P A; 1R8Q E; 1XT0 B; 3TW5 A; 1XSZ A; 3LTL A; 1PBV A; 4JK1 X; 4FHR B; 1S9D E; 3USY A; 2K6X A; 4L5M A; 4D7R A; 3AJC A; 3SWV A; 1R8S E; 2R0D A; 1Q8D A; 3HJL A; 1R8M E; 2HSN A; 4FQ0 C; 4JMI A; 4A4P A; 1KU1 A; 4JMO A; 2R09 A; 4C0A A; 4D7Q A; 4JXH A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
