1MG2B

Mutation of alpha phe55 of methylamine dehydrogenase alters the reorganization energy and electronic coupling for its electron transfer reaction with amicyanin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine dehydrogenase, heavy chain
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
publication title MUTATION OF AlPHA PHE55 OF METHYLAMINE DEHYDROGENASE ALTERS THE REORGANIZATION ENERGY AND ELECTRONIC COUPLING FOR ITS ELECTRON TRANSFER REACTION WITH AMICYANIN
pubmed doi rcsb
total genus 34
structure length 124
sequence length 125
chains with identical sequence F, J, N
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2002-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 1mg2B00
4FANC 4FAVC 3PXWC 2OJYD 2H47B 2I0RD 4FA4C 3SJLC 4FB1C 2BBKL 2AH0D 2Q7QD 3SLEC 2AGLD 3L4MC 2HKRD 2J57K 2OK6D 4L3HC 2GC4B 2AGZD 2AGXD 2HXCD 2AGYD 3L4OC 3RN0C 2I0TD 1MAEL 3C75L 2HJBD 4L3GC 2IUPD 2HKMD 2H3XB 2I0SD 4FA1C 2IUQD 4L1QC 4O1QC 4FA9C 3SVWC 2OIZD 1MDAL 3RMZC 2GC7B 2IAAB 3SWSC 2OK4D 4Y5RC 1MG3B 3RLMC 1MG2B 1MAFL 3ORVC 2AGWD 2J55L 2MADL 2AH1D 2J56L 4FA5C 2IURD 2HJ4D 4K3IC 3SXTC 3RN1C 3PXTC 2IUVD 2MTAL 3PXSC
chains in the Genus database with same CATH superfamily
4FANC 4FAVC 3PXWC 2OJYD 2H47B 2I0RD 4FA4C 3SJLC 4FB1C 2BBKL 2AH0D 2Q7QD 3SLEC 2AGLD 3L4MC 2HKRD 2J57K 2OK6D 4L3HC 2GC4B 2AGZD 2AGXD 2HXCD 2AGYD 3L4OC 3RN0C 2I0TD 1MAEL 3C75L 2HJBD 4L3GC 2IUPD 2HKMD 2H3XB 2I0SD 4FA1C 2IUQD 4L1QC 4O1QC 4FA9C 3SVWC 2OIZD 1MDAL 3RMZC 2GC7B 2IAAB 3SWSC 2OK4D 4Y5RC 1MG3B 3RLMC 1MG2B 1MAFL 3ORVC 2AGWD 2J55L 2MADL 2AH1D 2J56L 4FA5C 2IURD 2HJ4D 4K3IC 3SXTC 3RN1C 3PXTC 2IUVD 2MTAL 3PXSC
chains in the Genus database with same CATH topology
4FANC 4FAVC 3PXWC 2OJYD 2H47B 2I0RD 4FA4C 3SJLC 4FB1C 2BBKL 2AH0D 2Q7QD 3SLEC 2AGLD 3L4MC 2HKRD 2J57K 2OK6D 4L3HC 2GC4B 2AGZD 2AGXD 2HXCD 2AGYD 3L4OC 3RN0C 2I0TD 1MAEL 3C75L 2HJBD 4L3GC 2IUPD 2HKMD 2H3XB 2I0SD 4FA1C 2IUQD 4L1QC 4O1QC 4FA9C 3SVWC 2OIZD 1MDAL 3RMZC 2GC7B 2IAAB 3SWSC 2OK4D 4Y5RC 1MG3B 3RLMC 1MG2B 1MAFL 3ORVC 2AGWD 2J55L 2MADL 2AH1D 2J56L 4FA5C 2IURD 2HJ4D 4K3IC 3SXTC 3RN1C 3PXTC 2IUVD 2MTAL 3PXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAN C;  4FAV C;  3PXW C;  2OJY D;  2H47 B;  2I0R D;  4FA4 C;  3SJL C;  4FB1 C;  2BBK L;  2AH0 D;  2Q7Q D;  3SLE C;  2AGL D;  3L4M C;  2HKR D;  2J57 K;  2OK6 D;  4L3H C;  2GC4 B;  2AGZ D;  2AGX D;  2HXC D;  2AGY D;  3L4O C;  3RN0 C;  2I0T D;  1MAE L;  3C75 L;  2HJB D;  4L3G C;  2IUP D;  2HKM D;  2H3X B;  2I0S D;  4FA1 C;  2IUQ D;  4L1Q C;  4O1Q C;  4FA9 C;  3SVW C;  2OIZ D;  1MDA L;  3RMZ C;  2GC7 B;  2IAA B;  3SWS C;  2OK4 D;  4Y5R C;  1MG3 B;  3RLM C;  1MG2 B;  1MAF L;  3ORV C;  2AGW D;  2J55 L;  2MAD L;  2AH1 D;  2J56 L;  4FA5 C;  2IUR D;  2HJ4 D;  4K3I C;  3SXT C;  3RN1 C;  3PXT C;  2IUV D;  2MTA L;  3PXS C; 
#chains in the Genus database with same CATH topology
 4FAN C;  4FAV C;  3PXW C;  2OJY D;  2H47 B;  2I0R D;  4FA4 C;  3SJL C;  4FB1 C;  2BBK L;  2AH0 D;  2Q7Q D;  3SLE C;  2AGL D;  3L4M C;  2HKR D;  2J57 K;  2OK6 D;  4L3H C;  2GC4 B;  2AGZ D;  2AGX D;  2HXC D;  2AGY D;  3L4O C;  3RN0 C;  2I0T D;  1MAE L;  3C75 L;  2HJB D;  4L3G C;  2IUP D;  2HKM D;  2H3X B;  2I0S D;  4FA1 C;  2IUQ D;  4L1Q C;  4O1Q C;  4FA9 C;  3SVW C;  2OIZ D;  1MDA L;  3RMZ C;  2GC7 B;  2IAA B;  3SWS C;  2OK4 D;  4Y5R C;  1MG3 B;  3RLM C;  1MG2 B;  1MAF L;  3ORV C;  2AGW D;  2J55 L;  2MAD L;  2AH1 D;  2J56 L;  4FA5 C;  2IUR D;  2HJ4 D;  4K3I C;  3SXT C;  3RN1 C;  3PXT C;  2IUV D;  2MTA L;  3PXS C; 
#chains in the Genus database with same CATH homology
 4FAN C;  4FAV C;  3PXW C;  2OJY D;  2H47 B;  2I0R D;  4FA4 C;  3SJL C;  4FB1 C;  2BBK L;  2AH0 D;  2Q7Q D;  3SLE C;  2AGL D;  3L4M C;  2HKR D;  2J57 K;  2OK6 D;  4L3H C;  2GC4 B;  2AGZ D;  2AGX D;  2HXC D;  2AGY D;  3L4O C;  3RN0 C;  2I0T D;  1MAE L;  3C75 L;  2HJB D;  4L3G C;  2IUP D;  2HKM D;  2H3X B;  2I0S D;  4FA1 C;  2IUQ D;  4L1Q C;  4O1Q C;  4FA9 C;  3SVW C;  2OIZ D;  1MDA L;  3RMZ C;  2GC7 B;  2IAA B;  3SWS C;  2OK4 D;  4Y5R C;  1MG3 B;  3RLM C;  1MG2 B;  1MAF L;  3ORV C;  2AGW D;  2J55 L;  2MAD L;  2AH1 D;  2J56 L;  4FA5 C;  2IUR D;  2HJ4 D;  4K3I C;  3SXT C;  3RN1 C;  3PXT C;  2IUV D;  2MTA L;  3PXS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...