The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
85
|
structure length |
85
|
Chain Sequence |
TLPISLDWSTEEVIDVVHFFQAIEQAYDQGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKAREEMEEHIQM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of an unknown conserved protein - Pfam: UPF0223
rcsb |
| molecule keywords |
UPF0223 protein BH2638
|
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bacillus halodurans c-125
|
| total genus |
28
|
| structure length |
85
|
| sequence length |
85
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2007-02-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05256 | UPF0223 | Uncharacterised protein family (UPF0223) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Annexin V; domain 1 | BH2638-like |
#chains in the Genus database with same CATH superfamily 2OY9 A; #chains in the Genus database with same CATH topology 1HVG A; 4KN7 X; 3ANY A; 1N44 A; 1UPT B; 1YCN A; 1R8Q E; 1R8S E; 2HYV A; 1AII A; 1AVH A; 1W45 A; 1BCW A; 4MDU A; 1XJL A; 4JK1 X; 3AJC A; 1ANW A; 1YGM A; 3USY A; 3ABQ A; 2HYU A; 3TW5 A; 1W3W A; 1R8M E; 3SWV A; 1AEI A; 1BC9 A; 2XO2 A; 1AVR A; 1S9D E; 4KN4 X; 1HAK A; 1SAV A; 4OIY A; 1HVE A; 3LTL A; 2K6X A; 2ZHI A; 4A4P A; 1XT0 B; 3USW A; 4JXH A; 1ANX A; 1N41 A; 4L5M A; 2HSN A; 1ANN A; 2IE6 A; 2XO3 A; 4HRE A; 1XSZ A; 3L8N A; 1BO9 A; 1A8A A; 2IIC A; 2IE7 A; 4D7R A; 1QC7 A; 1W7B A; 1M9I A; 1N42 A; 3HJL A; 1HVF A; 2H0M A; 4FHR B; 2HYW A; 4JWL A; 1BC3 A; 2II2 A; 4JMI A; 3SOH B; 1YJ0 A; 1BCY A; 1KU1 A; 2ZOC A; 1R4A E; 1YII A; 2R0D A; 1BC0 A; 3ABS A; 1AVC A; 4FQ0 C; 4X9P A; 1HM6 A; 3AO0 A; 4KMU X; 3ABR A; 1G5N A; 1PBV A; 2R09 A; 4C0A A; 1C1K A; 1I4A A; 3ABO A; 2OY9 A; 4EVH A; 4D7Q A; 1DK5 A; 4MDV A; 1A8B A; 1BCZ A; 2H0K A; 2VXG A; 4JMO A; 4Z21 A; 1AXN A; 1DM5 A; 1LKV X; 1HVD A; 1MCX A; 3BRX A; 4EVF A; 1N00 A; 1AOW A; 2RAN A; 2Q4C A; 1BC1 A; 2H0L A; 1ALA A; 1RE0 B; 2QEZ A; 4Q2S A; 2ZHJ A; 1Q8D A; 4C7P A; #chains in the Genus database with same CATH homology 2OY9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
