2AGWD

Crystal structure of tryptamine-reduced aromatic amine dehydrogenase (aadh) from alcaligenes faecalis in complex with tryptamine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
Knots found
sequence length
109
structure length
108
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
molecule tags Oxidoreductase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 27
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2agwD00
4L1QC 3C75L 3SWSC 4L3GC 2OK6D 4K3IC 2OK4D 2H3XB 2AGXD 3PXWC 3L4OC 4FAVC 2HXCD 3PXSC 2Q7QD 2AGWD 2HKRD 4FA4C 2OIZD 3PXTC 3SJLC 2AH0D 2AGLD 2I0SD 2MADL 3RLMC 1MDAL 3SLEC 4FA5C 4FA9C 2HJ4D 2AGZD 1MAFL 4Y5RC 2AH1D 3SXTC 2J55L 4FB1C 2IUVD 3ORVC 2H47B 2IUQD 1MAEL 1MG3B 4FA1C 2HKMD 2J56L 2J57K 3L4MC 2I0RD 2IURD 3SVWC 2OJYD 3RMZC 2HJBD 2GC4B 4FANC 4L3HC 3RN1C 2IAAB 1MG2B 2GC7B 2I0TD 2AGYD 2BBKL 2IUPD 3RN0C 2MTAL 4O1QC
chains in the Genus database with same CATH superfamily
4L1QC 3C75L 3SWSC 4L3GC 2OK6D 4K3IC 2OK4D 2H3XB 2AGXD 3PXWC 3L4OC 4FAVC 2HXCD 3PXSC 2Q7QD 2AGWD 2HKRD 4FA4C 2OIZD 3PXTC 3SJLC 2AH0D 2AGLD 2I0SD 2MADL 3RLMC 1MDAL 3SLEC 4FA5C 4FA9C 2HJ4D 2AGZD 1MAFL 4Y5RC 2AH1D 3SXTC 2J55L 4FB1C 2IUVD 3ORVC 2H47B 2IUQD 1MAEL 1MG3B 4FA1C 2HKMD 2J56L 2J57K 3L4MC 2I0RD 2IURD 3SVWC 2OJYD 3RMZC 2HJBD 2GC4B 4FANC 4L3HC 3RN1C 2IAAB 1MG2B 2GC7B 2I0TD 2AGYD 2BBKL 2IUPD 3RN0C 2MTAL 4O1QC
chains in the Genus database with same CATH topology
4L1QC 3C75L 3SWSC 4L3GC 2OK6D 4K3IC 2OK4D 2H3XB 2AGXD 3PXWC 3L4OC 4FAVC 2HXCD 3PXSC 2Q7QD 2AGWD 2HKRD 4FA4C 2OIZD 3PXTC 3SJLC 2AH0D 2AGLD 2I0SD 2MADL 3RLMC 1MDAL 3SLEC 4FA5C 4FA9C 2HJ4D 2AGZD 1MAFL 4Y5RC 2AH1D 3SXTC 2J55L 4FB1C 2IUVD 3ORVC 2H47B 2IUQD 1MAEL 1MG3B 4FA1C 2HKMD 2J56L 2J57K 3L4MC 2I0RD 2IURD 3SVWC 2OJYD 3RMZC 2HJBD 2GC4B 4FANC 4L3HC 3RN1C 2IAAB 1MG2B 2GC7B 2I0TD 2AGYD 2BBKL 2IUPD 3RN0C 2MTAL 4O1QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1Q C;  3C75 L;  3SWS C;  4L3G C;  2OK6 D;  4K3I C;  2OK4 D;  2H3X B;  2AGX D;  3PXW C;  3L4O C;  4FAV C;  2HXC D;  3PXS C;  2Q7Q D;  2AGW D;  2HKR D;  4FA4 C;  2OIZ D;  3PXT C;  3SJL C;  2AH0 D;  2AGL D;  2I0S D;  2MAD L;  3RLM C;  1MDA L;  3SLE C;  4FA5 C;  4FA9 C;  2HJ4 D;  2AGZ D;  1MAF L;  4Y5R C;  2AH1 D;  3SXT C;  2J55 L;  4FB1 C;  2IUV D;  3ORV C;  2H47 B;  2IUQ D;  1MAE L;  1MG3 B;  4FA1 C;  2HKM D;  2J56 L;  2J57 K;  3L4M C;  2I0R D;  2IUR D;  3SVW C;  2OJY D;  3RMZ C;  2HJB D;  2GC4 B;  4FAN C;  4L3H C;  3RN1 C;  2IAA B;  1MG2 B;  2GC7 B;  2I0T D;  2AGY D;  2BBK L;  2IUP D;  3RN0 C;  2MTA L;  4O1Q C; 
#chains in the Genus database with same CATH topology
 4L1Q C;  3C75 L;  3SWS C;  4L3G C;  2OK6 D;  4K3I C;  2OK4 D;  2H3X B;  2AGX D;  3PXW C;  3L4O C;  4FAV C;  2HXC D;  3PXS C;  2Q7Q D;  2AGW D;  2HKR D;  4FA4 C;  2OIZ D;  3PXT C;  3SJL C;  2AH0 D;  2AGL D;  2I0S D;  2MAD L;  3RLM C;  1MDA L;  3SLE C;  4FA5 C;  4FA9 C;  2HJ4 D;  2AGZ D;  1MAF L;  4Y5R C;  2AH1 D;  3SXT C;  2J55 L;  4FB1 C;  2IUV D;  3ORV C;  2H47 B;  2IUQ D;  1MAE L;  1MG3 B;  4FA1 C;  2HKM D;  2J56 L;  2J57 K;  3L4M C;  2I0R D;  2IUR D;  3SVW C;  2OJY D;  3RMZ C;  2HJB D;  2GC4 B;  4FAN C;  4L3H C;  3RN1 C;  2IAA B;  1MG2 B;  2GC7 B;  2I0T D;  2AGY D;  2BBK L;  2IUP D;  3RN0 C;  2MTA L;  4O1Q C; 
#chains in the Genus database with same CATH homology
 4L1Q C;  3C75 L;  3SWS C;  4L3G C;  2OK6 D;  4K3I C;  2OK4 D;  2H3X B;  2AGX D;  3PXW C;  3L4O C;  4FAV C;  2HXC D;  3PXS C;  2Q7Q D;  2AGW D;  2HKR D;  4FA4 C;  2OIZ D;  3PXT C;  3SJL C;  2AH0 D;  2AGL D;  2I0S D;  2MAD L;  3RLM C;  1MDA L;  3SLE C;  4FA5 C;  4FA9 C;  2HJ4 D;  2AGZ D;  1MAF L;  4Y5R C;  2AH1 D;  3SXT C;  2J55 L;  4FB1 C;  2IUV D;  3ORV C;  2H47 B;  2IUQ D;  1MAE L;  1MG3 B;  4FA1 C;  2HKM D;  2J56 L;  2J57 K;  3L4M C;  2I0R D;  2IUR D;  3SVW C;  2OJY D;  3RMZ C;  2HJB D;  2GC4 B;  4FAN C;  4L3H C;  3RN1 C;  2IAA B;  1MG2 B;  2GC7 B;  2I0T D;  2AGY D;  2BBK L;  2IUP D;  3RN0 C;  2MTA L;  4O1Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...