2BBKL

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
Knots found
sequence length
125
structure length
124
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence M
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2bbkL00
2AH0D 4FANC 4L3HC 3ORVC 1MG3B 4Y5RC 2IUVD 2IUPD 4K3IC 2IUQD 2HJ4D 2J56L 2OIZD 1MDAL 2OK4D 2AGWD 2H47B 3RLMC 3RN0C 1MG2B 2GC4B 4L3GC 3RMZC 4FAVC 3SWSC 2IURD 2AGYD 2I0TD 2AGLD 4FB1C 3SJLC 4FA5C 2OK6D 4L1QC 3SXTC 2AGXD 3SVWC 2AGZD 2I0RD 3PXSC 3PXTC 1MAFL 2HKMD 2I0SD 2J55L 2GC7B 2H3XB 2Q7QD 1MAEL 3L4MC 3L4OC 2BBKL 3PXWC 3RN1C 2HXCD 3C75L 4O1QC 2MADL 4FA9C 2J57K 2MTAL 2AH1D 2IAAB 4FA1C 2OJYD 2HKRD 4FA4C 2HJBD 3SLEC
chains in the Genus database with same CATH superfamily
2AH0D 4FANC 4L3HC 3ORVC 1MG3B 4Y5RC 2IUVD 2IUPD 4K3IC 2IUQD 2HJ4D 2J56L 2OIZD 1MDAL 2OK4D 2AGWD 2H47B 3RLMC 3RN0C 1MG2B 2GC4B 4L3GC 3RMZC 4FAVC 3SWSC 2IURD 2AGYD 2I0TD 2AGLD 4FB1C 3SJLC 4FA5C 2OK6D 4L1QC 3SXTC 2AGXD 3SVWC 2AGZD 2I0RD 3PXSC 3PXTC 1MAFL 2HKMD 2I0SD 2J55L 2GC7B 2H3XB 2Q7QD 1MAEL 3L4MC 3L4OC 2BBKL 3PXWC 3RN1C 2HXCD 3C75L 4O1QC 2MADL 4FA9C 2J57K 2MTAL 2AH1D 2IAAB 4FA1C 2OJYD 2HKRD 4FA4C 2HJBD 3SLEC
chains in the Genus database with same CATH topology
2AH0D 4FANC 4L3HC 3ORVC 1MG3B 4Y5RC 2IUVD 2IUPD 4K3IC 2IUQD 2HJ4D 2J56L 2OIZD 1MDAL 2OK4D 2AGWD 2H47B 3RLMC 3RN0C 1MG2B 2GC4B 4L3GC 3RMZC 4FAVC 3SWSC 2IURD 2AGYD 2I0TD 2AGLD 4FB1C 3SJLC 4FA5C 2OK6D 4L1QC 3SXTC 2AGXD 3SVWC 2AGZD 2I0RD 3PXSC 3PXTC 1MAFL 2HKMD 2I0SD 2J55L 2GC7B 2H3XB 2Q7QD 1MAEL 3L4MC 3L4OC 2BBKL 3PXWC 3RN1C 2HXCD 3C75L 4O1QC 2MADL 4FA9C 2J57K 2MTAL 2AH1D 2IAAB 4FA1C 2OJYD 2HKRD 4FA4C 2HJBD 3SLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AH0 D;  4FAN C;  4L3H C;  3ORV C;  1MG3 B;  4Y5R C;  2IUV D;  2IUP D;  4K3I C;  2IUQ D;  2HJ4 D;  2J56 L;  2OIZ D;  1MDA L;  2OK4 D;  2AGW D;  2H47 B;  3RLM C;  3RN0 C;  1MG2 B;  2GC4 B;  4L3G C;  3RMZ C;  4FAV C;  3SWS C;  2IUR D;  2AGY D;  2I0T D;  2AGL D;  4FB1 C;  3SJL C;  4FA5 C;  2OK6 D;  4L1Q C;  3SXT C;  2AGX D;  3SVW C;  2AGZ D;  2I0R D;  3PXS C;  3PXT C;  1MAF L;  2HKM D;  2I0S D;  2J55 L;  2GC7 B;  2H3X B;  2Q7Q D;  1MAE L;  3L4M C;  3L4O C;  2BBK L;  3PXW C;  3RN1 C;  2HXC D;  3C75 L;  4O1Q C;  2MAD L;  4FA9 C;  2J57 K;  2MTA L;  2AH1 D;  2IAA B;  4FA1 C;  2OJY D;  2HKR D;  4FA4 C;  2HJB D;  3SLE C; 
#chains in the Genus database with same CATH topology
 2AH0 D;  4FAN C;  4L3H C;  3ORV C;  1MG3 B;  4Y5R C;  2IUV D;  2IUP D;  4K3I C;  2IUQ D;  2HJ4 D;  2J56 L;  2OIZ D;  1MDA L;  2OK4 D;  2AGW D;  2H47 B;  3RLM C;  3RN0 C;  1MG2 B;  2GC4 B;  4L3G C;  3RMZ C;  4FAV C;  3SWS C;  2IUR D;  2AGY D;  2I0T D;  2AGL D;  4FB1 C;  3SJL C;  4FA5 C;  2OK6 D;  4L1Q C;  3SXT C;  2AGX D;  3SVW C;  2AGZ D;  2I0R D;  3PXS C;  3PXT C;  1MAF L;  2HKM D;  2I0S D;  2J55 L;  2GC7 B;  2H3X B;  2Q7Q D;  1MAE L;  3L4M C;  3L4O C;  2BBK L;  3PXW C;  3RN1 C;  2HXC D;  3C75 L;  4O1Q C;  2MAD L;  4FA9 C;  2J57 K;  2MTA L;  2AH1 D;  2IAA B;  4FA1 C;  2OJY D;  2HKR D;  4FA4 C;  2HJB D;  3SLE C; 
#chains in the Genus database with same CATH homology
 2AH0 D;  4FAN C;  4L3H C;  3ORV C;  1MG3 B;  4Y5R C;  2IUV D;  2IUP D;  4K3I C;  2IUQ D;  2HJ4 D;  2J56 L;  2OIZ D;  1MDA L;  2OK4 D;  2AGW D;  2H47 B;  3RLM C;  3RN0 C;  1MG2 B;  2GC4 B;  4L3G C;  3RMZ C;  4FAV C;  3SWS C;  2IUR D;  2AGY D;  2I0T D;  2AGL D;  4FB1 C;  3SJL C;  4FA5 C;  2OK6 D;  4L1Q C;  3SXT C;  2AGX D;  3SVW C;  2AGZ D;  2I0R D;  3PXS C;  3PXT C;  1MAF L;  2HKM D;  2I0S D;  2J55 L;  2GC7 B;  2H3X B;  2Q7Q D;  1MAE L;  3L4M C;  3L4O C;  2BBK L;  3PXW C;  3RN1 C;  2HXC D;  3C75 L;  4O1Q C;  2MAD L;  4FA9 C;  2J57 K;  2MTA L;  2AH1 D;  2IAA B;  4FA1 C;  2OJY D;  2HKR D;  4FA4 C;  2HJB D;  3SLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...