2H47B

Crystal structure of an electron transfer complex between aromatic amine dephydrogenase and azurin from alcaligenes faecalis (form 1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
Knots found
sequence length
124
structure length
123
Chain Sequence
HISLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic Amine Dehydrogenase
publication title Crystal Structure of an Electron Transfer Complex between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes faecalis.
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 30
structure length 123
sequence length 124
chains with identical sequence E, G, I
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2h47B00
3RLMC 2AH0D 2I0TD 4L3HC 3L4OC 3RN0C 2AGZD 2AGXD 2IAAB 4O1QC 3ORVC 3SXTC 2I0RD 2MTAL 3PXTC 3SVWC 4FA5C 2IUPD 2Q7QD 1MG2B 3PXWC 2H47B 4Y5RC 2AGWD 2AGLD 2AH1D 2IUQD 2OK6D 4FANC 2HKRD 2OIZD 3SWSC 4FB1C 2HXCD 3RMZC 1MAEL 4K3IC 1MDAL 1MG3B 2H3XB 1MAFL 2HKMD 4FAVC 3RN1C 2GC4B 2HJBD 4L3GC 4FA4C 2J55L 3L4MC 4FA9C 2I0SD 3SJLC 2BBKL 2J57K 2AGYD 2IURD 2MADL 2J56L 2OK4D 3C75L 3PXSC 4L1QC 3SLEC 4FA1C 2IUVD 2HJ4D 2OJYD 2GC7B
chains in the Genus database with same CATH superfamily
3RLMC 2AH0D 2I0TD 4L3HC 3L4OC 3RN0C 2AGZD 2AGXD 2IAAB 4O1QC 3ORVC 3SXTC 2I0RD 2MTAL 3PXTC 3SVWC 4FA5C 2IUPD 2Q7QD 1MG2B 3PXWC 2H47B 4Y5RC 2AGWD 2AGLD 2AH1D 2IUQD 2OK6D 4FANC 2HKRD 2OIZD 3SWSC 4FB1C 2HXCD 3RMZC 1MAEL 4K3IC 1MDAL 1MG3B 2H3XB 1MAFL 2HKMD 4FAVC 3RN1C 2GC4B 2HJBD 4L3GC 4FA4C 2J55L 3L4MC 4FA9C 2I0SD 3SJLC 2BBKL 2J57K 2AGYD 2IURD 2MADL 2J56L 2OK4D 3C75L 3PXSC 4L1QC 3SLEC 4FA1C 2IUVD 2HJ4D 2OJYD 2GC7B
chains in the Genus database with same CATH topology
3RLMC 2AH0D 2I0TD 4L3HC 3L4OC 3RN0C 2AGZD 2AGXD 2IAAB 4O1QC 3ORVC 3SXTC 2I0RD 2MTAL 3PXTC 3SVWC 4FA5C 2IUPD 2Q7QD 1MG2B 3PXWC 2H47B 4Y5RC 2AGWD 2AGLD 2AH1D 2IUQD 2OK6D 4FANC 2HKRD 2OIZD 3SWSC 4FB1C 2HXCD 3RMZC 1MAEL 4K3IC 1MDAL 1MG3B 2H3XB 1MAFL 2HKMD 4FAVC 3RN1C 2GC4B 2HJBD 4L3GC 4FA4C 2J55L 3L4MC 4FA9C 2I0SD 3SJLC 2BBKL 2J57K 2AGYD 2IURD 2MADL 2J56L 2OK4D 3C75L 3PXSC 4L1QC 3SLEC 4FA1C 2IUVD 2HJ4D 2OJYD 2GC7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLM C;  2AH0 D;  2I0T D;  4L3H C;  3L4O C;  3RN0 C;  2AGZ D;  2AGX D;  2IAA B;  4O1Q C;  3ORV C;  3SXT C;  2I0R D;  2MTA L;  3PXT C;  3SVW C;  4FA5 C;  2IUP D;  2Q7Q D;  1MG2 B;  3PXW C;  2H47 B;  4Y5R C;  2AGW D;  2AGL D;  2AH1 D;  2IUQ D;  2OK6 D;  4FAN C;  2HKR D;  2OIZ D;  3SWS C;  4FB1 C;  2HXC D;  3RMZ C;  1MAE L;  4K3I C;  1MDA L;  1MG3 B;  2H3X B;  1MAF L;  2HKM D;  4FAV C;  3RN1 C;  2GC4 B;  2HJB D;  4L3G C;  4FA4 C;  2J55 L;  3L4M C;  4FA9 C;  2I0S D;  3SJL C;  2BBK L;  2J57 K;  2AGY D;  2IUR D;  2MAD L;  2J56 L;  2OK4 D;  3C75 L;  3PXS C;  4L1Q C;  3SLE C;  4FA1 C;  2IUV D;  2HJ4 D;  2OJY D;  2GC7 B; 
#chains in the Genus database with same CATH topology
 3RLM C;  2AH0 D;  2I0T D;  4L3H C;  3L4O C;  3RN0 C;  2AGZ D;  2AGX D;  2IAA B;  4O1Q C;  3ORV C;  3SXT C;  2I0R D;  2MTA L;  3PXT C;  3SVW C;  4FA5 C;  2IUP D;  2Q7Q D;  1MG2 B;  3PXW C;  2H47 B;  4Y5R C;  2AGW D;  2AGL D;  2AH1 D;  2IUQ D;  2OK6 D;  4FAN C;  2HKR D;  2OIZ D;  3SWS C;  4FB1 C;  2HXC D;  3RMZ C;  1MAE L;  4K3I C;  1MDA L;  1MG3 B;  2H3X B;  1MAF L;  2HKM D;  4FAV C;  3RN1 C;  2GC4 B;  2HJB D;  4L3G C;  4FA4 C;  2J55 L;  3L4M C;  4FA9 C;  2I0S D;  3SJL C;  2BBK L;  2J57 K;  2AGY D;  2IUR D;  2MAD L;  2J56 L;  2OK4 D;  3C75 L;  3PXS C;  4L1Q C;  3SLE C;  4FA1 C;  2IUV D;  2HJ4 D;  2OJY D;  2GC7 B; 
#chains in the Genus database with same CATH homology
 3RLM C;  2AH0 D;  2I0T D;  4L3H C;  3L4O C;  3RN0 C;  2AGZ D;  2AGX D;  2IAA B;  4O1Q C;  3ORV C;  3SXT C;  2I0R D;  2MTA L;  3PXT C;  3SVW C;  4FA5 C;  2IUP D;  2Q7Q D;  1MG2 B;  3PXW C;  2H47 B;  4Y5R C;  2AGW D;  2AGL D;  2AH1 D;  2IUQ D;  2OK6 D;  4FAN C;  2HKR D;  2OIZ D;  3SWS C;  4FB1 C;  2HXC D;  3RMZ C;  1MAE L;  4K3I C;  1MDA L;  1MG3 B;  2H3X B;  1MAF L;  2HKM D;  4FAV C;  3RN1 C;  2GC4 B;  2HJB D;  4L3G C;  4FA4 C;  2J55 L;  3L4M C;  4FA9 C;  2I0S D;  3SJL C;  2BBK L;  2J57 K;  2AGY D;  2IUR D;  2MAD L;  2J56 L;  2OK4 D;  3C75 L;  3PXS C;  4L1Q C;  3SLE C;  4FA1 C;  2IUV D;  2HJ4 D;  2OJY D;  2GC7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...