2IURD

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form a cocrystal
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2iurD00
2J57K 2OK6D 4L3GC 2IUPD 2AGZD 2AGWD 3RN0C 2HKRD 2BBKL 2HKMD 1MAFL 2I0SD 2IAAB 2J56L 2J55L 2OJYD 2Q7QD 3C75L 3SJLC 2AGYD 2HJBD 4FB1C 4FA9C 1MG2B 4FAVC 3SVWC 2AH1D 3SXTC 4FA4C 4Y5RC 2GC7B 1MDAL 2I0TD 3PXWC 3RLMC 3SLEC 3RN1C 3RMZC 4FANC 2IURD 1MAEL 1MG3B 4FA1C 2IUVD 2H3XB 2GC4B 2OIZD 4L3HC 2OK4D 2HXCD 2HJ4D 3PXTC 3L4OC 2AGXD 2AH0D 2H47B 2I0RD 3ORVC 4O1QC 4L1QC 4FA5C 3SWSC 2IUQD 2MTAL 3PXSC 2AGLD 4K3IC 3L4MC 2MADL
chains in the Genus database with same CATH superfamily
2J57K 2OK6D 4L3GC 2IUPD 2AGZD 2AGWD 3RN0C 2HKRD 2BBKL 2HKMD 1MAFL 2I0SD 2IAAB 2J56L 2J55L 2OJYD 2Q7QD 3C75L 3SJLC 2AGYD 2HJBD 4FB1C 4FA9C 1MG2B 4FAVC 3SVWC 2AH1D 3SXTC 4FA4C 4Y5RC 2GC7B 1MDAL 2I0TD 3PXWC 3RLMC 3SLEC 3RN1C 3RMZC 4FANC 2IURD 1MAEL 1MG3B 4FA1C 2IUVD 2H3XB 2GC4B 2OIZD 4L3HC 2OK4D 2HXCD 2HJ4D 3PXTC 3L4OC 2AGXD 2AH0D 2H47B 2I0RD 3ORVC 4O1QC 4L1QC 4FA5C 3SWSC 2IUQD 2MTAL 3PXSC 2AGLD 4K3IC 3L4MC 2MADL
chains in the Genus database with same CATH topology
2J57K 2OK6D 4L3GC 2IUPD 2AGZD 2AGWD 3RN0C 2HKRD 2BBKL 2HKMD 1MAFL 2I0SD 2IAAB 2J56L 2J55L 2OJYD 2Q7QD 3C75L 3SJLC 2AGYD 2HJBD 4FB1C 4FA9C 1MG2B 4FAVC 3SVWC 2AH1D 3SXTC 4FA4C 4Y5RC 2GC7B 1MDAL 2I0TD 3PXWC 3RLMC 3SLEC 3RN1C 3RMZC 4FANC 2IURD 1MAEL 1MG3B 4FA1C 2IUVD 2H3XB 2GC4B 2OIZD 4L3HC 2OK4D 2HXCD 2HJ4D 3PXTC 3L4OC 2AGXD 2AH0D 2H47B 2I0RD 3ORVC 4O1QC 4L1QC 4FA5C 3SWSC 2IUQD 2MTAL 3PXSC 2AGLD 4K3IC 3L4MC 2MADL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J57 K;  2OK6 D;  4L3G C;  2IUP D;  2AGZ D;  2AGW D;  3RN0 C;  2HKR D;  2BBK L;  2HKM D;  1MAF L;  2I0S D;  2IAA B;  2J56 L;  2J55 L;  2OJY D;  2Q7Q D;  3C75 L;  3SJL C;  2AGY D;  2HJB D;  4FB1 C;  4FA9 C;  1MG2 B;  4FAV C;  3SVW C;  2AH1 D;  3SXT C;  4FA4 C;  4Y5R C;  2GC7 B;  1MDA L;  2I0T D;  3PXW C;  3RLM C;  3SLE C;  3RN1 C;  3RMZ C;  4FAN C;  2IUR D;  1MAE L;  1MG3 B;  4FA1 C;  2IUV D;  2H3X B;  2GC4 B;  2OIZ D;  4L3H C;  2OK4 D;  2HXC D;  2HJ4 D;  3PXT C;  3L4O C;  2AGX D;  2AH0 D;  2H47 B;  2I0R D;  3ORV C;  4O1Q C;  4L1Q C;  4FA5 C;  3SWS C;  2IUQ D;  2MTA L;  3PXS C;  2AGL D;  4K3I C;  3L4M C;  2MAD L; 
#chains in the Genus database with same CATH topology
 2J57 K;  2OK6 D;  4L3G C;  2IUP D;  2AGZ D;  2AGW D;  3RN0 C;  2HKR D;  2BBK L;  2HKM D;  1MAF L;  2I0S D;  2IAA B;  2J56 L;  2J55 L;  2OJY D;  2Q7Q D;  3C75 L;  3SJL C;  2AGY D;  2HJB D;  4FB1 C;  4FA9 C;  1MG2 B;  4FAV C;  3SVW C;  2AH1 D;  3SXT C;  4FA4 C;  4Y5R C;  2GC7 B;  1MDA L;  2I0T D;  3PXW C;  3RLM C;  3SLE C;  3RN1 C;  3RMZ C;  4FAN C;  2IUR D;  1MAE L;  1MG3 B;  4FA1 C;  2IUV D;  2H3X B;  2GC4 B;  2OIZ D;  4L3H C;  2OK4 D;  2HXC D;  2HJ4 D;  3PXT C;  3L4O C;  2AGX D;  2AH0 D;  2H47 B;  2I0R D;  3ORV C;  4O1Q C;  4L1Q C;  4FA5 C;  3SWS C;  2IUQ D;  2MTA L;  3PXS C;  2AGL D;  4K3I C;  3L4M C;  2MAD L; 
#chains in the Genus database with same CATH homology
 2J57 K;  2OK6 D;  4L3G C;  2IUP D;  2AGZ D;  2AGW D;  3RN0 C;  2HKR D;  2BBK L;  2HKM D;  1MAF L;  2I0S D;  2IAA B;  2J56 L;  2J55 L;  2OJY D;  2Q7Q D;  3C75 L;  3SJL C;  2AGY D;  2HJB D;  4FB1 C;  4FA9 C;  1MG2 B;  4FAV C;  3SVW C;  2AH1 D;  3SXT C;  4FA4 C;  4Y5R C;  2GC7 B;  1MDA L;  2I0T D;  3PXW C;  3RLM C;  3SLE C;  3RN1 C;  3RMZ C;  4FAN C;  2IUR D;  1MAE L;  1MG3 B;  4FA1 C;  2IUV D;  2H3X B;  2GC4 B;  2OIZ D;  4L3H C;  2OK4 D;  2HXC D;  2HJ4 D;  3PXT C;  3L4O C;  2AGX D;  2AH0 D;  2H47 B;  2I0R D;  3ORV C;  4O1Q C;  4L1Q C;  4FA5 C;  3SWS C;  2IUQ D;  2MTA L;  3PXS C;  2AGL D;  4K3I C;  3L4M C;  2MAD L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...