2MTAL

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
Knots found
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
total genus 29
structure length 124
sequence length 125
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2mtaL00
2IAAB 4L3HC 3RN1C 4FB1C 4L1QC 4L3GC 4FA4C 2Q7QD 2I0SD 3C75L 2J56L 3RMZC 2J55L 2HJBD 3SVWC 2IURD 2OIZD 2AH1D 3PXWC 2BBKL 2IUQD 2OK6D 2MTAL 4FAVC 3SLEC 2AGXD 2HKMD 2HXCD 2I0TD 2H3XB 4O1QC 4FA1C 4Y5RC 2GC7B 4FA9C 1MAFL 2AGLD 2OJYD 3ORVC 3L4MC 3SXTC 2I0RD 2HJ4D 2J57K 1MDAL 3L4OC 2HKRD 2IUVD 2GC4B 3SJLC 3PXSC 3RLMC 1MG2B 2AH0D 2IUPD 2AGZD 3RN0C 1MG3B 2OK4D 3PXTC 2H47B 4FANC 1MAEL 3SWSC 2MADL 2AGWD 4K3IC 4FA5C 2AGYD
chains in the Genus database with same CATH superfamily
2IAAB 4L3HC 3RN1C 4FB1C 4L1QC 4L3GC 4FA4C 2Q7QD 2I0SD 3C75L 2J56L 3RMZC 2J55L 2HJBD 3SVWC 2IURD 2OIZD 2AH1D 3PXWC 2BBKL 2IUQD 2OK6D 2MTAL 4FAVC 3SLEC 2AGXD 2HKMD 2HXCD 2I0TD 2H3XB 4O1QC 4FA1C 4Y5RC 2GC7B 4FA9C 1MAFL 2AGLD 2OJYD 3ORVC 3L4MC 3SXTC 2I0RD 2HJ4D 2J57K 1MDAL 3L4OC 2HKRD 2IUVD 2GC4B 3SJLC 3PXSC 3RLMC 1MG2B 2AH0D 2IUPD 2AGZD 3RN0C 1MG3B 2OK4D 3PXTC 2H47B 4FANC 1MAEL 3SWSC 2MADL 2AGWD 4K3IC 4FA5C 2AGYD
chains in the Genus database with same CATH topology
2IAAB 4L3HC 3RN1C 4FB1C 4L1QC 4L3GC 4FA4C 2Q7QD 2I0SD 3C75L 2J56L 3RMZC 2J55L 2HJBD 3SVWC 2IURD 2OIZD 2AH1D 3PXWC 2BBKL 2IUQD 2OK6D 2MTAL 4FAVC 3SLEC 2AGXD 2HKMD 2HXCD 2I0TD 2H3XB 4O1QC 4FA1C 4Y5RC 2GC7B 4FA9C 1MAFL 2AGLD 2OJYD 3ORVC 3L4MC 3SXTC 2I0RD 2HJ4D 2J57K 1MDAL 3L4OC 2HKRD 2IUVD 2GC4B 3SJLC 3PXSC 3RLMC 1MG2B 2AH0D 2IUPD 2AGZD 3RN0C 1MG3B 2OK4D 3PXTC 2H47B 4FANC 1MAEL 3SWSC 2MADL 2AGWD 4K3IC 4FA5C 2AGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAA B;  4L3H C;  3RN1 C;  4FB1 C;  4L1Q C;  4L3G C;  4FA4 C;  2Q7Q D;  2I0S D;  3C75 L;  2J56 L;  3RMZ C;  2J55 L;  2HJB D;  3SVW C;  2IUR D;  2OIZ D;  2AH1 D;  3PXW C;  2BBK L;  2IUQ D;  2OK6 D;  2MTA L;  4FAV C;  3SLE C;  2AGX D;  2HKM D;  2HXC D;  2I0T D;  2H3X B;  4O1Q C;  4FA1 C;  4Y5R C;  2GC7 B;  4FA9 C;  1MAF L;  2AGL D;  2OJY D;  3ORV C;  3L4M C;  3SXT C;  2I0R D;  2HJ4 D;  2J57 K;  1MDA L;  3L4O C;  2HKR D;  2IUV D;  2GC4 B;  3SJL C;  3PXS C;  3RLM C;  1MG2 B;  2AH0 D;  2IUP D;  2AGZ D;  3RN0 C;  1MG3 B;  2OK4 D;  3PXT C;  2H47 B;  4FAN C;  1MAE L;  3SWS C;  2MAD L;  2AGW D;  4K3I C;  4FA5 C;  2AGY D; 
#chains in the Genus database with same CATH topology
 2IAA B;  4L3H C;  3RN1 C;  4FB1 C;  4L1Q C;  4L3G C;  4FA4 C;  2Q7Q D;  2I0S D;  3C75 L;  2J56 L;  3RMZ C;  2J55 L;  2HJB D;  3SVW C;  2IUR D;  2OIZ D;  2AH1 D;  3PXW C;  2BBK L;  2IUQ D;  2OK6 D;  2MTA L;  4FAV C;  3SLE C;  2AGX D;  2HKM D;  2HXC D;  2I0T D;  2H3X B;  4O1Q C;  4FA1 C;  4Y5R C;  2GC7 B;  4FA9 C;  1MAF L;  2AGL D;  2OJY D;  3ORV C;  3L4M C;  3SXT C;  2I0R D;  2HJ4 D;  2J57 K;  1MDA L;  3L4O C;  2HKR D;  2IUV D;  2GC4 B;  3SJL C;  3PXS C;  3RLM C;  1MG2 B;  2AH0 D;  2IUP D;  2AGZ D;  3RN0 C;  1MG3 B;  2OK4 D;  3PXT C;  2H47 B;  4FAN C;  1MAE L;  3SWS C;  2MAD L;  2AGW D;  4K3I C;  4FA5 C;  2AGY D; 
#chains in the Genus database with same CATH homology
 2IAA B;  4L3H C;  3RN1 C;  4FB1 C;  4L1Q C;  4L3G C;  4FA4 C;  2Q7Q D;  2I0S D;  3C75 L;  2J56 L;  3RMZ C;  2J55 L;  2HJB D;  3SVW C;  2IUR D;  2OIZ D;  2AH1 D;  3PXW C;  2BBK L;  2IUQ D;  2OK6 D;  2MTA L;  4FAV C;  3SLE C;  2AGX D;  2HKM D;  2HXC D;  2I0T D;  2H3X B;  4O1Q C;  4FA1 C;  4Y5R C;  2GC7 B;  4FA9 C;  1MAF L;  2AGL D;  2OJY D;  3ORV C;  3L4M C;  3SXT C;  2I0R D;  2HJ4 D;  2J57 K;  1MDA L;  3L4O C;  2HKR D;  2IUV D;  2GC4 B;  3SJL C;  3PXS C;  3RLM C;  1MG2 B;  2AH0 D;  2IUP D;  2AGZ D;  3RN0 C;  1MG3 B;  2OK4 D;  3PXT C;  2H47 B;  4FAN C;  1MAE L;  3SWS C;  2MAD L;  2AGW D;  4K3I C;  4FA5 C;  2AGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...