2OJYD

Crystal structure of indol-3-acetaldehyde derived ttq-amide adduct of aromatic amine dehydrogenase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
molecule tags Oxidoreductase
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ojyD00
2I0SD 1MG2B 3SWSC 2J55L 2AGXD 2HJBD 2AGLD 2GC7B 2AH1D 3ORVC 4FANC 2J56L 2OIZD 3L4OC 4FB1C 1MG3B 3PXSC 1MAEL 2IURD 3SXTC 4FA1C 4FA5C 3SJLC 4FA9C 3SLEC 2I0TD 2IUVD 3RN0C 2OJYD 3C75L 3L4MC 2OK4D 3RN1C 4FAVC 2IUPD 3PXTC 3RLMC 2MADL 2H3XB 3SVWC 2AGZD 2IUQD 4FA4C 1MDAL 4K3IC 4O1QC 2GC4B 1MAFL 2HKMD 2H47B 2J57K 2AH0D 2HKRD 2HXCD 2OK6D 4Y5RC 2IAAB 2BBKL 2AGWD 2MTAL 2I0RD 4L1QC 4L3HC 2Q7QD 2AGYD 4L3GC 3RMZC 3PXWC 2HJ4D
chains in the Genus database with same CATH superfamily
2I0SD 1MG2B 3SWSC 2J55L 2AGXD 2HJBD 2AGLD 2GC7B 2AH1D 3ORVC 4FANC 2J56L 2OIZD 3L4OC 4FB1C 1MG3B 3PXSC 1MAEL 2IURD 3SXTC 4FA1C 4FA5C 3SJLC 4FA9C 3SLEC 2I0TD 2IUVD 3RN0C 2OJYD 3C75L 3L4MC 2OK4D 3RN1C 4FAVC 2IUPD 3PXTC 3RLMC 2MADL 2H3XB 3SVWC 2AGZD 2IUQD 4FA4C 1MDAL 4K3IC 4O1QC 2GC4B 1MAFL 2HKMD 2H47B 2J57K 2AH0D 2HKRD 2HXCD 2OK6D 4Y5RC 2IAAB 2BBKL 2AGWD 2MTAL 2I0RD 4L1QC 4L3HC 2Q7QD 2AGYD 4L3GC 3RMZC 3PXWC 2HJ4D
chains in the Genus database with same CATH topology
2I0SD 1MG2B 3SWSC 2J55L 2AGXD 2HJBD 2AGLD 2GC7B 2AH1D 3ORVC 4FANC 2J56L 2OIZD 3L4OC 4FB1C 1MG3B 3PXSC 1MAEL 2IURD 3SXTC 4FA1C 4FA5C 3SJLC 4FA9C 3SLEC 2I0TD 2IUVD 3RN0C 2OJYD 3C75L 3L4MC 2OK4D 3RN1C 4FAVC 2IUPD 3PXTC 3RLMC 2MADL 2H3XB 3SVWC 2AGZD 2IUQD 4FA4C 1MDAL 4K3IC 4O1QC 2GC4B 1MAFL 2HKMD 2H47B 2J57K 2AH0D 2HKRD 2HXCD 2OK6D 4Y5RC 2IAAB 2BBKL 2AGWD 2MTAL 2I0RD 4L1QC 4L3HC 2Q7QD 2AGYD 4L3GC 3RMZC 3PXWC 2HJ4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0S D;  1MG2 B;  3SWS C;  2J55 L;  2AGX D;  2HJB D;  2AGL D;  2GC7 B;  2AH1 D;  3ORV C;  4FAN C;  2J56 L;  2OIZ D;  3L4O C;  4FB1 C;  1MG3 B;  3PXS C;  1MAE L;  2IUR D;  3SXT C;  4FA1 C;  4FA5 C;  3SJL C;  4FA9 C;  3SLE C;  2I0T D;  2IUV D;  3RN0 C;  2OJY D;  3C75 L;  3L4M C;  2OK4 D;  3RN1 C;  4FAV C;  2IUP D;  3PXT C;  3RLM C;  2MAD L;  2H3X B;  3SVW C;  2AGZ D;  2IUQ D;  4FA4 C;  1MDA L;  4K3I C;  4O1Q C;  2GC4 B;  1MAF L;  2HKM D;  2H47 B;  2J57 K;  2AH0 D;  2HKR D;  2HXC D;  2OK6 D;  4Y5R C;  2IAA B;  2BBK L;  2AGW D;  2MTA L;  2I0R D;  4L1Q C;  4L3H C;  2Q7Q D;  2AGY D;  4L3G C;  3RMZ C;  3PXW C;  2HJ4 D; 
#chains in the Genus database with same CATH topology
 2I0S D;  1MG2 B;  3SWS C;  2J55 L;  2AGX D;  2HJB D;  2AGL D;  2GC7 B;  2AH1 D;  3ORV C;  4FAN C;  2J56 L;  2OIZ D;  3L4O C;  4FB1 C;  1MG3 B;  3PXS C;  1MAE L;  2IUR D;  3SXT C;  4FA1 C;  4FA5 C;  3SJL C;  4FA9 C;  3SLE C;  2I0T D;  2IUV D;  3RN0 C;  2OJY D;  3C75 L;  3L4M C;  2OK4 D;  3RN1 C;  4FAV C;  2IUP D;  3PXT C;  3RLM C;  2MAD L;  2H3X B;  3SVW C;  2AGZ D;  2IUQ D;  4FA4 C;  1MDA L;  4K3I C;  4O1Q C;  2GC4 B;  1MAF L;  2HKM D;  2H47 B;  2J57 K;  2AH0 D;  2HKR D;  2HXC D;  2OK6 D;  4Y5R C;  2IAA B;  2BBK L;  2AGW D;  2MTA L;  2I0R D;  4L1Q C;  4L3H C;  2Q7Q D;  2AGY D;  4L3G C;  3RMZ C;  3PXW C;  2HJ4 D; 
#chains in the Genus database with same CATH homology
 2I0S D;  1MG2 B;  3SWS C;  2J55 L;  2AGX D;  2HJB D;  2AGL D;  2GC7 B;  2AH1 D;  3ORV C;  4FAN C;  2J56 L;  2OIZ D;  3L4O C;  4FB1 C;  1MG3 B;  3PXS C;  1MAE L;  2IUR D;  3SXT C;  4FA1 C;  4FA5 C;  3SJL C;  4FA9 C;  3SLE C;  2I0T D;  2IUV D;  3RN0 C;  2OJY D;  3C75 L;  3L4M C;  2OK4 D;  3RN1 C;  4FAV C;  2IUP D;  3PXT C;  3RLM C;  2MAD L;  2H3X B;  3SVW C;  2AGZ D;  2IUQ D;  4FA4 C;  1MDA L;  4K3I C;  4O1Q C;  2GC4 B;  1MAF L;  2HKM D;  2H47 B;  2J57 K;  2AH0 D;  2HKR D;  2HXC D;  2OK6 D;  4Y5R C;  2IAA B;  2BBK L;  2AGW D;  2MTA L;  2I0R D;  4L1Q C;  4L3H C;  2Q7Q D;  2AGY D;  4L3G C;  3RMZ C;  3PXW C;  2HJ4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...