2Q7QD

Crystal structure of alcaligenes faecalis aadh in complex with p-chlorobenzylamine.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
Knots found
sequence length
109
structure length
108
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aralkylamine dehydrogenase light chain
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Isotope effects reveal that para-substituted benzylamines are poor reactivity probes of the quinoprotein mechanism for aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 24
structure length 108
sequence length 109
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2q7qD00
2HKMD 2AGYD 4O1QC 2IAAB 1MDAL 1MAFL 2AGWD 2GC4B 2GC7B 2IUPD 2H3XB 3C75L 2HJ4D 2HKRD 3ORVC 3SVWC 4FAVC 2HJBD 2AH0D 1MAEL 1MG3B 4FB1C 2IURD 4FA1C 2OK4D 2MTAL 3SLEC 4K3IC 1MG2B 3L4OC 2I0RD 2Q7QD 2IUVD 2J55L 2IUQD 3L4MC 4L3HC 2AGZD 2AGXD 3PXSC 4FA5C 4L1QC 2I0TD 3RMZC 3PXWC 3SWSC 3RN0C 2MADL 4FA4C 2HXCD 3SJLC 3PXTC 2AH1D 2J57K 4FA9C 2OIZD 2OJYD 2AGLD 2BBKL 2OK6D 2J56L 4FANC 3SXTC 4L3GC 3RN1C 2I0SD 2H47B 4Y5RC 3RLMC
chains in the Genus database with same CATH superfamily
2HKMD 2AGYD 4O1QC 2IAAB 1MDAL 1MAFL 2AGWD 2GC4B 2GC7B 2IUPD 2H3XB 3C75L 2HJ4D 2HKRD 3ORVC 3SVWC 4FAVC 2HJBD 2AH0D 1MAEL 1MG3B 4FB1C 2IURD 4FA1C 2OK4D 2MTAL 3SLEC 4K3IC 1MG2B 3L4OC 2I0RD 2Q7QD 2IUVD 2J55L 2IUQD 3L4MC 4L3HC 2AGZD 2AGXD 3PXSC 4FA5C 4L1QC 2I0TD 3RMZC 3PXWC 3SWSC 3RN0C 2MADL 4FA4C 2HXCD 3SJLC 3PXTC 2AH1D 2J57K 4FA9C 2OIZD 2OJYD 2AGLD 2BBKL 2OK6D 2J56L 4FANC 3SXTC 4L3GC 3RN1C 2I0SD 2H47B 4Y5RC 3RLMC
chains in the Genus database with same CATH topology
2HKMD 2AGYD 4O1QC 2IAAB 1MDAL 1MAFL 2AGWD 2GC4B 2GC7B 2IUPD 2H3XB 3C75L 2HJ4D 2HKRD 3ORVC 3SVWC 4FAVC 2HJBD 2AH0D 1MAEL 1MG3B 4FB1C 2IURD 4FA1C 2OK4D 2MTAL 3SLEC 4K3IC 1MG2B 3L4OC 2I0RD 2Q7QD 2IUVD 2J55L 2IUQD 3L4MC 4L3HC 2AGZD 2AGXD 3PXSC 4FA5C 4L1QC 2I0TD 3RMZC 3PXWC 3SWSC 3RN0C 2MADL 4FA4C 2HXCD 3SJLC 3PXTC 2AH1D 2J57K 4FA9C 2OIZD 2OJYD 2AGLD 2BBKL 2OK6D 2J56L 4FANC 3SXTC 4L3GC 3RN1C 2I0SD 2H47B 4Y5RC 3RLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKM D;  2AGY D;  4O1Q C;  2IAA B;  1MDA L;  1MAF L;  2AGW D;  2GC4 B;  2GC7 B;  2IUP D;  2H3X B;  3C75 L;  2HJ4 D;  2HKR D;  3ORV C;  3SVW C;  4FAV C;  2HJB D;  2AH0 D;  1MAE L;  1MG3 B;  4FB1 C;  2IUR D;  4FA1 C;  2OK4 D;  2MTA L;  3SLE C;  4K3I C;  1MG2 B;  3L4O C;  2I0R D;  2Q7Q D;  2IUV D;  2J55 L;  2IUQ D;  3L4M C;  4L3H C;  2AGZ D;  2AGX D;  3PXS C;  4FA5 C;  4L1Q C;  2I0T D;  3RMZ C;  3PXW C;  3SWS C;  3RN0 C;  2MAD L;  4FA4 C;  2HXC D;  3SJL C;  3PXT C;  2AH1 D;  2J57 K;  4FA9 C;  2OIZ D;  2OJY D;  2AGL D;  2BBK L;  2OK6 D;  2J56 L;  4FAN C;  3SXT C;  4L3G C;  3RN1 C;  2I0S D;  2H47 B;  4Y5R C;  3RLM C; 
#chains in the Genus database with same CATH topology
 2HKM D;  2AGY D;  4O1Q C;  2IAA B;  1MDA L;  1MAF L;  2AGW D;  2GC4 B;  2GC7 B;  2IUP D;  2H3X B;  3C75 L;  2HJ4 D;  2HKR D;  3ORV C;  3SVW C;  4FAV C;  2HJB D;  2AH0 D;  1MAE L;  1MG3 B;  4FB1 C;  2IUR D;  4FA1 C;  2OK4 D;  2MTA L;  3SLE C;  4K3I C;  1MG2 B;  3L4O C;  2I0R D;  2Q7Q D;  2IUV D;  2J55 L;  2IUQ D;  3L4M C;  4L3H C;  2AGZ D;  2AGX D;  3PXS C;  4FA5 C;  4L1Q C;  2I0T D;  3RMZ C;  3PXW C;  3SWS C;  3RN0 C;  2MAD L;  4FA4 C;  2HXC D;  3SJL C;  3PXT C;  2AH1 D;  2J57 K;  4FA9 C;  2OIZ D;  2OJY D;  2AGL D;  2BBK L;  2OK6 D;  2J56 L;  4FAN C;  3SXT C;  4L3G C;  3RN1 C;  2I0S D;  2H47 B;  4Y5R C;  3RLM C; 
#chains in the Genus database with same CATH homology
 2HKM D;  2AGY D;  4O1Q C;  2IAA B;  1MDA L;  1MAF L;  2AGW D;  2GC4 B;  2GC7 B;  2IUP D;  2H3X B;  3C75 L;  2HJ4 D;  2HKR D;  3ORV C;  3SVW C;  4FAV C;  2HJB D;  2AH0 D;  1MAE L;  1MG3 B;  4FB1 C;  2IUR D;  4FA1 C;  2OK4 D;  2MTA L;  3SLE C;  4K3I C;  1MG2 B;  3L4O C;  2I0R D;  2Q7Q D;  2IUV D;  2J55 L;  2IUQ D;  3L4M C;  4L3H C;  2AGZ D;  2AGX D;  3PXS C;  4FA5 C;  4L1Q C;  2I0T D;  3RMZ C;  3PXW C;  3SWS C;  3RN0 C;  2MAD L;  4FA4 C;  2HXC D;  3SJL C;  3PXT C;  2AH1 D;  2J57 K;  4FA9 C;  2OIZ D;  2OJY D;  2AGL D;  2BBK L;  2OK6 D;  2J56 L;  4FAN C;  3SXT C;  4L3G C;  3RN1 C;  2I0S D;  2H47 B;  4Y5R C;  3RLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...