The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
129
|
sequence length |
356
|
structure length |
345
|
Chain Sequence |
GADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPMLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANAMRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIILPKLAANRAKLEEVAGKYNLQVAGIYDISNKRRMGLTEFQAVKEMQDGILELIKIEKEM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystallization and X-Ray Diffraction Studies of Arginine Kinase from the White Pacific Shrimp Litopenaeus Vannamei.
pubmed doi rcsb |
| molecule keywords |
ARGININE KINASE
|
| molecule tags |
Transferase
|
| total genus |
129
|
| structure length |
345
|
| sequence length |
356
|
| ec nomenclature |
ec
2.7.3.3: Arginine kinase. |
| pdb deposition date | 2012-03-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00217 | ATP-gua_Ptrans | ATP:guanido phosphotransferase, C-terminal catalytic domain |
| A | PF02807 | ATP-gua_PtransN | ATP:guanido phosphotransferase, N-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Transferase Creatine Kinase; Chain A, domain 1 | ATP:guanido phosphotransferase, N-terminal domain | ||
| Alpha Beta | 2-Layer Sandwich | Creatine Kinase; Chain A, domain 2 | Glutamine synthetase/guanido kinase, catalytic domain |
#chains in the Genus database with same CATH superfamily 2LGS A; 3L2E A; 3DRB A; 1RL9 A; 2BVC A; 3B6R A; 1VRP A; 1F52 A; 4S0R A; 1P50 A; 4BG4 A; 4LNF A; 4LNO A; 5J9A A; 3L2E B; 2WGS A; 2WHI A; 3ZXR A; 4GVZ A; 4ACF A; 4AM1 A; 1G0W A; 2CRK A; 4GW0 A; 4RF6 A; 4BG4 B; 4GW2 A; 1HTO A; 3NG0 A; 4LNK A; 4LNI A; 4S17 A; 4RF7 A; 1FPY A; 1BG0 A; 4GVY A; 1P52 A; 3JQ3 A; 1F1H A; 1I0E A; 4XYC A; 4RF9 A; 4HPP A; 1U6R A; 4RF8 A; 1QK1 A; 3M10 A; 1LGR A; 1SD0 A; 1CRK A; 2GLS A; 1HTQ A; 3JU5 A; 3L2D A; 4Q2R A; 4LNN A; 2J1Q A; 3JU6 A; 3ZXV A; 3DRE A; 5J99 A; 1M15 A; 4BHL A; 3JPZ A; 4Z9M A; 1QH4 A; #chains in the Genus database with same CATH topology 2BVC A; 1VRP A; 2QC8 A; 1P50 A; 4LNO A; 2D3A A; 3L2E B; 2WGS A; 2WHI A; 3IG5 A; 4AM1 A; 1G0W A; 4BAX A; 1TT4 A; 4GVY A; 1P52 A; 1I0E A; 4RF9 A; 1QK1 A; 3M10 A; 3LN7 A; 2D32 A; 2GWD A; 3IG8 A; 1SD0 A; 2GLS A; 2J1Q A; 3DRE A; 4Z9M A; 1QH4 A; 3L2E A; 4S0R A; 4BG4 B; 4S17 A; 4RF7 A; 3LN6 A; 2D3C A; 1F1H A; 4XYC A; 2D33 A; 1LGR A; 1CRK A; 3JU5 A; 3ZXV A; 4BHL A; 2LGS A; 3DRB A; 1RL9 A; 1F52 A; 4BG4 A; 5J9A A; 4LNK A; 2CRK A; 2UU7 A; 4GW2 A; 1BG0 A; 3JQ3 A; 1V4G A; 4HPP A; 1U6R A; 4RF8 A; 2GWC A; 1R8G A; 1HTQ A; 3L2D A; 4LNN A; 1VA6 A; 5J99 A; 1M15 A; 2OJW A; 3JPZ A; 3LVW A; 3B6R A; 2D3B A; 4LNF A; 3ZXR A; 4ACF A; 4GVZ A; 4GW0 A; 4RF6 A; 3NZT A; 1HTO A; 3NG0 A; 4LNI A; 1FPY A; 3FKY A; 4Q2R A; 3JU6 A; 3LVV A; #chains in the Genus database with same CATH homology 2LGS A; 3L2E A; 3DRB A; 1RL9 A; 2BVC A; 3B6R A; 1VRP A; 1F52 A; 4S0R A; 1P50 A; 4BG4 A; 4LNF A; 4LNO A; 5J9A A; 3L2E B; 2WGS A; 2WHI A; 3ZXR A; 4GVZ A; 4ACF A; 4AM1 A; 1G0W A; 2CRK A; 4GW0 A; 4RF6 A; 4BG4 B; 4GW2 A; 1HTO A; 3NG0 A; 4LNK A; 4LNI A; 4S17 A; 4RF7 A; 1FPY A; 1BG0 A; 4GVY A; 1P52 A; 3JQ3 A; 1F1H A; 1I0E A; 4XYC A; 4RF9 A; 4HPP A; 1U6R A; 4RF8 A; 1QK1 A; 3M10 A; 1LGR A; 1SD0 A; 1CRK A; 2GLS A; 1HTQ A; 3JU5 A; 3L2D A; 4Q2R A; 4LNN A; 2J1Q A; 3JU6 A; 3ZXV A; 3DRE A; 5J99 A; 1M15 A; 4BHL A; 3JPZ A; 4Z9M A; 1QH4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...